Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N5MZ70

Protein Details
Accession A0A5N5MZ70    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
150-182ESDSQKKEDKGKAKRPKKLSRAERRRQIKEELQBasic
NLS Segment(s)
PositionSequence
142-178KKDEGKKRESDSQKKEDKGKAKRPKKLSRAERRRQIK
Subcellular Location(s) nucl 14.5, mito_nucl 12.666, mito 9.5, cyto_nucl 9.333
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MLLTSSQVSIAVSSSVVVVFTAALFLSGYAIQQRTLRDLREAIKPSPRPKPQIFLPDRFKSTTTELEDGTVIVVDIPPGPDAYRPPRPDGEQVVVEVRPTVAGGDVTQRVTEGRKGDTVEVLREGKSERLQPGSQQELRDSKKDEGKKRESDSQKKEDKGKAKRPKKLSRAERRRQIKEELQKMSQGDRRGLWQPRLW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.06
4 0.06
5 0.05
6 0.05
7 0.05
8 0.05
9 0.04
10 0.04
11 0.04
12 0.04
13 0.06
14 0.06
15 0.06
16 0.09
17 0.1
18 0.11
19 0.14
20 0.15
21 0.21
22 0.23
23 0.24
24 0.24
25 0.28
26 0.29
27 0.35
28 0.39
29 0.36
30 0.42
31 0.47
32 0.5
33 0.56
34 0.6
35 0.59
36 0.58
37 0.6
38 0.57
39 0.62
40 0.62
41 0.6
42 0.62
43 0.59
44 0.59
45 0.55
46 0.49
47 0.42
48 0.4
49 0.37
50 0.33
51 0.29
52 0.27
53 0.26
54 0.25
55 0.21
56 0.17
57 0.11
58 0.06
59 0.04
60 0.04
61 0.03
62 0.04
63 0.04
64 0.04
65 0.05
66 0.05
67 0.06
68 0.1
69 0.16
70 0.23
71 0.25
72 0.28
73 0.3
74 0.33
75 0.35
76 0.35
77 0.32
78 0.25
79 0.24
80 0.22
81 0.19
82 0.17
83 0.13
84 0.09
85 0.06
86 0.05
87 0.05
88 0.03
89 0.03
90 0.04
91 0.06
92 0.07
93 0.08
94 0.08
95 0.08
96 0.08
97 0.09
98 0.12
99 0.11
100 0.12
101 0.14
102 0.15
103 0.15
104 0.18
105 0.18
106 0.16
107 0.17
108 0.17
109 0.15
110 0.15
111 0.15
112 0.15
113 0.17
114 0.19
115 0.19
116 0.22
117 0.23
118 0.25
119 0.3
120 0.35
121 0.35
122 0.32
123 0.34
124 0.37
125 0.4
126 0.41
127 0.39
128 0.36
129 0.42
130 0.49
131 0.54
132 0.56
133 0.61
134 0.65
135 0.66
136 0.71
137 0.74
138 0.76
139 0.75
140 0.75
141 0.75
142 0.72
143 0.75
144 0.73
145 0.72
146 0.72
147 0.74
148 0.76
149 0.78
150 0.82
151 0.85
152 0.87
153 0.87
154 0.88
155 0.88
156 0.89
157 0.9
158 0.91
159 0.91
160 0.91
161 0.89
162 0.84
163 0.81
164 0.8
165 0.79
166 0.78
167 0.74
168 0.66
169 0.62
170 0.58
171 0.57
172 0.52
173 0.46
174 0.41
175 0.36
176 0.38
177 0.43
178 0.49