Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N5MU17

Protein Details
Accession A0A5N5MU17    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
13-45KVKSQCPKVEKQEKAKRPKGRAHKREQYTRRFVBasic
NLS Segment(s)
PositionSequence
21-38VEKQEKAKRPKGRAHKRE
Subcellular Location(s) nucl 14, mito 8, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVKSQCPKVEKQEKAKRPKGRAHKREQYTRRFVNVTLAPGGKRKMNPNPGAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.44
3 0.48
4 0.5
5 0.52
6 0.6
7 0.63
8 0.68
9 0.68
10 0.71
11 0.74
12 0.76
13 0.81
14 0.82
15 0.79
16 0.76
17 0.77
18 0.78
19 0.78
20 0.79
21 0.78
22 0.79
23 0.78
24 0.82
25 0.82
26 0.8
27 0.78
28 0.72
29 0.66
30 0.58
31 0.51
32 0.49
33 0.43
34 0.37
35 0.31
36 0.29
37 0.26
38 0.28
39 0.3
40 0.28
41 0.29
42 0.35
43 0.42
44 0.5