Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C5DM88

Protein Details
Accession C5DM88    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MGKRKKSSRGPAKRVVQKLDBasic
NLS Segment(s)
PositionSequence
3-13KRKKSSRGPAK
Subcellular Location(s) nucl 15, mito_nucl 12.666, cyto_nucl 10.166, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
KEGG lth:KLTH0G06864g  -  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKKSSRGPAKRVVQKLDLTFNCLFCNHEKSITCTLDKKNGIGSLSCKVCGQNFQTHINALSQPVDVYSDWFDAVEEVNAGKVSESEGESDSASDYESDSDAEQVDKRRAQIDSDEEEISEDEDAIGSSKRGRGKIVDSDEDEDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.79
3 0.73
4 0.67
5 0.63
6 0.62
7 0.53
8 0.49
9 0.44
10 0.39
11 0.35
12 0.3
13 0.28
14 0.22
15 0.27
16 0.23
17 0.26
18 0.26
19 0.31
20 0.38
21 0.39
22 0.37
23 0.37
24 0.39
25 0.42
26 0.42
27 0.37
28 0.32
29 0.31
30 0.3
31 0.26
32 0.26
33 0.23
34 0.23
35 0.23
36 0.2
37 0.18
38 0.18
39 0.21
40 0.23
41 0.23
42 0.25
43 0.28
44 0.28
45 0.28
46 0.28
47 0.25
48 0.21
49 0.15
50 0.13
51 0.09
52 0.08
53 0.08
54 0.08
55 0.07
56 0.08
57 0.08
58 0.08
59 0.08
60 0.08
61 0.07
62 0.06
63 0.06
64 0.05
65 0.04
66 0.03
67 0.04
68 0.04
69 0.04
70 0.04
71 0.04
72 0.04
73 0.05
74 0.06
75 0.07
76 0.08
77 0.09
78 0.09
79 0.09
80 0.09
81 0.07
82 0.07
83 0.06
84 0.06
85 0.06
86 0.06
87 0.06
88 0.06
89 0.07
90 0.07
91 0.08
92 0.1
93 0.13
94 0.18
95 0.19
96 0.2
97 0.23
98 0.23
99 0.24
100 0.27
101 0.29
102 0.29
103 0.3
104 0.29
105 0.26
106 0.26
107 0.24
108 0.19
109 0.13
110 0.09
111 0.06
112 0.06
113 0.06
114 0.06
115 0.07
116 0.07
117 0.09
118 0.14
119 0.19
120 0.21
121 0.23
122 0.27
123 0.33
124 0.42
125 0.47
126 0.48
127 0.47