Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N5JEH1

Protein Details
Accession A0A5N5JEH1    Localization Confidence Low Confidence Score 5.3
NoLS Segment(s)
PositionSequenceProtein Nature
26-56YFGKRFRTKGCLKRHKFKKTQRLQWPNSRFPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, plas 3, nucl 1, cyto 1, cyto_nucl 1, pero 1, cyto_pero 1
Family & Domain DBs
Amino Acid Sequences MHALRALCACQSFIVLIYGPDIPQAYFGKRFRTKGCLKRHKFKKTQRLQWPNSRFPGALQMRDLQRALSYGGGSQSTRARNTQEM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.09
3 0.09
4 0.1
5 0.1
6 0.09
7 0.09
8 0.09
9 0.08
10 0.11
11 0.13
12 0.14
13 0.21
14 0.22
15 0.31
16 0.35
17 0.39
18 0.38
19 0.45
20 0.51
21 0.53
22 0.62
23 0.64
24 0.66
25 0.73
26 0.81
27 0.82
28 0.83
29 0.84
30 0.83
31 0.82
32 0.86
33 0.86
34 0.86
35 0.83
36 0.83
37 0.81
38 0.76
39 0.7
40 0.62
41 0.5
42 0.41
43 0.45
44 0.37
45 0.32
46 0.27
47 0.29
48 0.29
49 0.32
50 0.31
51 0.21
52 0.18
53 0.18
54 0.17
55 0.13
56 0.12
57 0.1
58 0.12
59 0.13
60 0.13
61 0.15
62 0.2
63 0.23
64 0.26
65 0.28