Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N5JLG7

Protein Details
Accession A0A5N5JLG7    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
480-509NGNGHNKKMPPKAPPPRRRTKLKAVTSSADHydrophilic
NLS Segment(s)
PositionSequence
485-502NKKMPPKAPPPRRRTKLK
Subcellular Location(s) nucl 21.5, cyto_nucl 14, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR030125  SPIN90/Ldb17  
IPR018556  SPIN90/Ldb17_LRD  
Pfam View protein in Pfam  
PF09431  SPIN90_LRD  
Amino Acid Sequences MACQDEGTCCAIESEQQFWDELGKIIQSACDTSHEELDDALRGWLSLVSCCRDRFLHYEDDLASCSQELIDSRIFSDHKDYVRTQIIYSLLQEDEFCPLHVIANFLLLDGRSDETTFRKMIDAGCFARLLDLMKECRDQDGRLHRLLLELMYEMSRIEHLRIEDLMHVDDAFVMYLFQLIEAYSDDAHDPYHYPVIRVLLVLNEQYMVASTTSAVDPESPSVPLTNRVIKVLSVHGPHFRTFGENIILLLNRETETSLQLLILKLLYLLFTTKATYEYFYTNDLRVLLDVIIRNLLDLPNEVTALRHTYLRVLSPLLAHTQLSQPPHYKREEILKVLRILSGAGNAHFAPVDETTVRLVDRVAKVSWLAEDDEGSECGDVEVARKLLGISLSPTQSASSVSVVAGVMEKPGVKTPSRKTEFGPQSRDGMREVCDIVDAADQKTQLHMKSAARPTKVLPEVPKHRHGVPMGISKTTVVHLNGNGHNKKMPPKAPPPRRRTKLKAVTSSADAAVTPETLHPLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.2
4 0.2
5 0.2
6 0.22
7 0.18
8 0.17
9 0.15
10 0.13
11 0.13
12 0.13
13 0.14
14 0.13
15 0.13
16 0.13
17 0.16
18 0.19
19 0.21
20 0.24
21 0.23
22 0.22
23 0.21
24 0.21
25 0.19
26 0.16
27 0.14
28 0.11
29 0.1
30 0.1
31 0.11
32 0.11
33 0.13
34 0.16
35 0.2
36 0.24
37 0.25
38 0.27
39 0.27
40 0.3
41 0.32
42 0.33
43 0.37
44 0.34
45 0.37
46 0.36
47 0.35
48 0.33
49 0.27
50 0.23
51 0.14
52 0.14
53 0.1
54 0.1
55 0.1
56 0.12
57 0.15
58 0.15
59 0.16
60 0.2
61 0.2
62 0.2
63 0.26
64 0.27
65 0.27
66 0.31
67 0.32
68 0.33
69 0.4
70 0.4
71 0.34
72 0.33
73 0.32
74 0.28
75 0.28
76 0.24
77 0.17
78 0.16
79 0.17
80 0.13
81 0.15
82 0.15
83 0.14
84 0.13
85 0.13
86 0.15
87 0.15
88 0.16
89 0.12
90 0.15
91 0.14
92 0.12
93 0.13
94 0.1
95 0.11
96 0.1
97 0.11
98 0.09
99 0.09
100 0.11
101 0.14
102 0.17
103 0.17
104 0.16
105 0.16
106 0.17
107 0.2
108 0.22
109 0.24
110 0.23
111 0.24
112 0.23
113 0.22
114 0.21
115 0.18
116 0.15
117 0.13
118 0.15
119 0.16
120 0.18
121 0.21
122 0.21
123 0.25
124 0.25
125 0.24
126 0.28
127 0.36
128 0.38
129 0.37
130 0.38
131 0.33
132 0.32
133 0.32
134 0.24
135 0.14
136 0.1
137 0.09
138 0.08
139 0.08
140 0.07
141 0.07
142 0.08
143 0.08
144 0.09
145 0.1
146 0.11
147 0.12
148 0.13
149 0.14
150 0.14
151 0.14
152 0.14
153 0.11
154 0.11
155 0.09
156 0.08
157 0.07
158 0.06
159 0.04
160 0.04
161 0.03
162 0.04
163 0.04
164 0.04
165 0.04
166 0.04
167 0.05
168 0.05
169 0.06
170 0.05
171 0.06
172 0.07
173 0.07
174 0.07
175 0.07
176 0.08
177 0.08
178 0.14
179 0.14
180 0.14
181 0.15
182 0.17
183 0.16
184 0.15
185 0.14
186 0.1
187 0.1
188 0.1
189 0.09
190 0.07
191 0.06
192 0.06
193 0.06
194 0.06
195 0.05
196 0.04
197 0.05
198 0.05
199 0.06
200 0.06
201 0.06
202 0.06
203 0.06
204 0.08
205 0.08
206 0.08
207 0.08
208 0.09
209 0.09
210 0.12
211 0.15
212 0.18
213 0.18
214 0.18
215 0.19
216 0.18
217 0.19
218 0.18
219 0.19
220 0.15
221 0.16
222 0.2
223 0.21
224 0.22
225 0.21
226 0.19
227 0.17
228 0.16
229 0.16
230 0.13
231 0.12
232 0.12
233 0.12
234 0.11
235 0.09
236 0.09
237 0.08
238 0.06
239 0.06
240 0.06
241 0.06
242 0.07
243 0.07
244 0.07
245 0.06
246 0.07
247 0.07
248 0.07
249 0.06
250 0.05
251 0.04
252 0.04
253 0.04
254 0.03
255 0.04
256 0.04
257 0.05
258 0.06
259 0.06
260 0.07
261 0.08
262 0.09
263 0.1
264 0.11
265 0.11
266 0.14
267 0.15
268 0.14
269 0.14
270 0.14
271 0.12
272 0.11
273 0.1
274 0.08
275 0.08
276 0.08
277 0.07
278 0.08
279 0.07
280 0.07
281 0.07
282 0.07
283 0.06
284 0.06
285 0.07
286 0.07
287 0.07
288 0.07
289 0.07
290 0.08
291 0.1
292 0.1
293 0.1
294 0.09
295 0.12
296 0.13
297 0.13
298 0.14
299 0.12
300 0.12
301 0.12
302 0.12
303 0.12
304 0.11
305 0.1
306 0.1
307 0.13
308 0.15
309 0.16
310 0.19
311 0.23
312 0.26
313 0.31
314 0.32
315 0.31
316 0.3
317 0.38
318 0.39
319 0.39
320 0.4
321 0.4
322 0.39
323 0.38
324 0.36
325 0.27
326 0.23
327 0.17
328 0.15
329 0.12
330 0.1
331 0.11
332 0.1
333 0.1
334 0.09
335 0.09
336 0.08
337 0.08
338 0.09
339 0.08
340 0.09
341 0.09
342 0.1
343 0.1
344 0.08
345 0.09
346 0.13
347 0.15
348 0.17
349 0.16
350 0.16
351 0.17
352 0.17
353 0.17
354 0.13
355 0.12
356 0.09
357 0.09
358 0.1
359 0.11
360 0.11
361 0.1
362 0.09
363 0.07
364 0.07
365 0.07
366 0.06
367 0.06
368 0.08
369 0.08
370 0.08
371 0.09
372 0.09
373 0.1
374 0.1
375 0.09
376 0.1
377 0.13
378 0.14
379 0.14
380 0.15
381 0.13
382 0.13
383 0.14
384 0.13
385 0.1
386 0.1
387 0.09
388 0.1
389 0.09
390 0.09
391 0.09
392 0.07
393 0.07
394 0.07
395 0.07
396 0.08
397 0.12
398 0.15
399 0.17
400 0.25
401 0.33
402 0.43
403 0.48
404 0.49
405 0.48
406 0.56
407 0.63
408 0.63
409 0.63
410 0.54
411 0.55
412 0.55
413 0.53
414 0.44
415 0.36
416 0.31
417 0.26
418 0.25
419 0.19
420 0.17
421 0.15
422 0.14
423 0.16
424 0.15
425 0.13
426 0.15
427 0.15
428 0.14
429 0.19
430 0.21
431 0.18
432 0.21
433 0.26
434 0.28
435 0.37
436 0.46
437 0.49
438 0.48
439 0.49
440 0.47
441 0.51
442 0.51
443 0.47
444 0.45
445 0.48
446 0.56
447 0.61
448 0.66
449 0.6
450 0.58
451 0.59
452 0.53
453 0.5
454 0.46
455 0.49
456 0.44
457 0.41
458 0.4
459 0.34
460 0.33
461 0.28
462 0.25
463 0.17
464 0.19
465 0.21
466 0.28
467 0.33
468 0.42
469 0.43
470 0.41
471 0.43
472 0.44
473 0.49
474 0.52
475 0.52
476 0.51
477 0.6
478 0.69
479 0.77
480 0.83
481 0.84
482 0.86
483 0.89
484 0.9
485 0.88
486 0.88
487 0.87
488 0.87
489 0.87
490 0.82
491 0.78
492 0.71
493 0.65
494 0.54
495 0.44
496 0.34
497 0.25
498 0.2
499 0.15
500 0.12
501 0.1