Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N5PBE2

Protein Details
Accession A0A5N5PBE2    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
113-132CYCKADQVAVKKRRRNHSKDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 10.833, cyto 5, cyto_pero 4.333, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR045068  BACURD1-3  
IPR000210  BTB/POZ_dom  
IPR011333  SKP1/BTB/POZ_sf  
IPR003131  T1-type_BTB  
Gene Ontology GO:0051260  P:protein homooligomerization  
Pfam View protein in Pfam  
PF02214  BTB_2  
PROSITE View protein in PROSITE  
PS50097  BTB  
CDD cd18316  BTB_POZ_KCTD-like  
Amino Acid Sequences MSTMNLDRAVEPVVLDVGDKRFYTTIGSLTDRSGYFESLFSGRWPIPRREDGSIFVDADPKVFSRIVSYLRHGIFPLCYNPETGHDYSLYQEILAEAKYYQLPELELWLTDHCYCKADQVAVKKRRRNHSKDMIAAAIWQRLPHRTIMRVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.1
4 0.11
5 0.14
6 0.14
7 0.15
8 0.15
9 0.15
10 0.18
11 0.17
12 0.18
13 0.19
14 0.22
15 0.21
16 0.21
17 0.24
18 0.2
19 0.23
20 0.2
21 0.18
22 0.16
23 0.15
24 0.17
25 0.14
26 0.15
27 0.12
28 0.14
29 0.14
30 0.2
31 0.24
32 0.27
33 0.32
34 0.37
35 0.4
36 0.41
37 0.42
38 0.39
39 0.38
40 0.35
41 0.3
42 0.24
43 0.23
44 0.18
45 0.17
46 0.14
47 0.11
48 0.11
49 0.1
50 0.1
51 0.09
52 0.12
53 0.15
54 0.16
55 0.18
56 0.21
57 0.22
58 0.22
59 0.2
60 0.18
61 0.16
62 0.15
63 0.15
64 0.12
65 0.12
66 0.12
67 0.12
68 0.15
69 0.19
70 0.18
71 0.17
72 0.15
73 0.15
74 0.15
75 0.16
76 0.13
77 0.08
78 0.07
79 0.07
80 0.07
81 0.06
82 0.06
83 0.05
84 0.06
85 0.07
86 0.07
87 0.07
88 0.07
89 0.08
90 0.08
91 0.1
92 0.1
93 0.09
94 0.1
95 0.11
96 0.13
97 0.13
98 0.15
99 0.13
100 0.15
101 0.14
102 0.17
103 0.18
104 0.2
105 0.23
106 0.31
107 0.41
108 0.49
109 0.58
110 0.6
111 0.67
112 0.73
113 0.8
114 0.78
115 0.78
116 0.79
117 0.8
118 0.8
119 0.75
120 0.66
121 0.55
122 0.51
123 0.43
124 0.36
125 0.27
126 0.23
127 0.21
128 0.24
129 0.25
130 0.29
131 0.32