Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N5MYF7

Protein Details
Accession A0A5N5MYF7    Localization Confidence High Confidence Score 19.4
NoLS Segment(s)
PositionSequenceProtein Nature
4-23LSTSRTRRSRAPSPESQRSPHydrophilic
108-135LAARHFIKNRGKKKDKSKSEPKAPRGRDBasic
139-168GAPVPEKRPHRHRQRRRPHRHDRPAGPQPEBasic
NLS Segment(s)
PositionSequence
112-162HFIKNRGKKKDKSKSEPKAPRGRDDFVGAPVPEKRPHRHRQRRRPHRHDRP
299-323PKDVGGRRARVSGEGDRGRKRTRSR
Subcellular Location(s) nucl 17, cyto_nucl 11.5, mito 6, cyto 4
Family & Domain DBs
Amino Acid Sequences MPSLSTSRTRRSRAPSPESQRSPASDLFGKVAKGVLEYSIHHYLARQSSSTAKQSSSSSKSKEMPSKRSSSDDKSTRAFGFGSSNSNSRRDDPTHELISHLLRGAAALAARHFIKNRGKKKDKSKSEPKAPRGRDDFVGAPVPEKRPHRHRQRRRPHRHDRPAGPQPEIVVALDSLSAELARTTTNIRHMAGGRRPHRHRDGRCDVYEGLVSCASRLEASTERVRTGVNNIRNLGEAQLGGYPRRGEGGREWYGRAGPEWQGYGGNAEKREGSWVRTRPVSERAGSYVRTQAAPEESKPKDVGGRRARVSGEGDRGRKRTRSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.75
3 0.77
4 0.82
5 0.79
6 0.75
7 0.69
8 0.63
9 0.59
10 0.51
11 0.46
12 0.39
13 0.35
14 0.34
15 0.32
16 0.28
17 0.24
18 0.23
19 0.18
20 0.15
21 0.14
22 0.14
23 0.13
24 0.15
25 0.21
26 0.23
27 0.23
28 0.22
29 0.22
30 0.26
31 0.3
32 0.3
33 0.25
34 0.22
35 0.29
36 0.34
37 0.39
38 0.35
39 0.3
40 0.31
41 0.34
42 0.4
43 0.4
44 0.42
45 0.4
46 0.44
47 0.48
48 0.53
49 0.59
50 0.59
51 0.62
52 0.62
53 0.65
54 0.61
55 0.63
56 0.61
57 0.59
58 0.61
59 0.58
60 0.56
61 0.52
62 0.53
63 0.46
64 0.41
65 0.34
66 0.25
67 0.24
68 0.21
69 0.23
70 0.21
71 0.25
72 0.26
73 0.3
74 0.3
75 0.29
76 0.33
77 0.31
78 0.36
79 0.38
80 0.42
81 0.42
82 0.4
83 0.38
84 0.34
85 0.32
86 0.26
87 0.19
88 0.13
89 0.09
90 0.09
91 0.08
92 0.07
93 0.06
94 0.06
95 0.05
96 0.07
97 0.08
98 0.1
99 0.1
100 0.16
101 0.26
102 0.35
103 0.44
104 0.53
105 0.61
106 0.68
107 0.78
108 0.82
109 0.83
110 0.84
111 0.86
112 0.85
113 0.87
114 0.88
115 0.86
116 0.85
117 0.77
118 0.75
119 0.69
120 0.62
121 0.52
122 0.46
123 0.38
124 0.3
125 0.31
126 0.23
127 0.19
128 0.19
129 0.2
130 0.21
131 0.24
132 0.29
133 0.35
134 0.44
135 0.55
136 0.64
137 0.72
138 0.79
139 0.86
140 0.92
141 0.94
142 0.95
143 0.95
144 0.95
145 0.94
146 0.91
147 0.86
148 0.83
149 0.8
150 0.72
151 0.62
152 0.51
153 0.41
154 0.33
155 0.27
156 0.18
157 0.1
158 0.07
159 0.06
160 0.05
161 0.05
162 0.04
163 0.03
164 0.03
165 0.03
166 0.03
167 0.03
168 0.03
169 0.04
170 0.06
171 0.08
172 0.13
173 0.15
174 0.15
175 0.17
176 0.19
177 0.25
178 0.29
179 0.37
180 0.38
181 0.46
182 0.49
183 0.54
184 0.62
185 0.65
186 0.65
187 0.66
188 0.7
189 0.67
190 0.65
191 0.61
192 0.51
193 0.43
194 0.39
195 0.29
196 0.21
197 0.16
198 0.14
199 0.11
200 0.11
201 0.09
202 0.08
203 0.07
204 0.1
205 0.11
206 0.15
207 0.21
208 0.22
209 0.22
210 0.22
211 0.22
212 0.19
213 0.25
214 0.29
215 0.29
216 0.32
217 0.33
218 0.33
219 0.34
220 0.33
221 0.26
222 0.19
223 0.13
224 0.1
225 0.11
226 0.12
227 0.11
228 0.13
229 0.12
230 0.12
231 0.15
232 0.14
233 0.14
234 0.19
235 0.27
236 0.32
237 0.33
238 0.34
239 0.33
240 0.34
241 0.32
242 0.27
243 0.22
244 0.18
245 0.18
246 0.18
247 0.17
248 0.17
249 0.16
250 0.19
251 0.2
252 0.21
253 0.2
254 0.2
255 0.19
256 0.19
257 0.26
258 0.25
259 0.25
260 0.3
261 0.35
262 0.39
263 0.43
264 0.45
265 0.42
266 0.47
267 0.48
268 0.41
269 0.38
270 0.39
271 0.38
272 0.38
273 0.36
274 0.35
275 0.32
276 0.3
277 0.27
278 0.26
279 0.29
280 0.31
281 0.31
282 0.35
283 0.34
284 0.38
285 0.38
286 0.36
287 0.37
288 0.4
289 0.47
290 0.48
291 0.55
292 0.54
293 0.57
294 0.56
295 0.52
296 0.52
297 0.48
298 0.48
299 0.48
300 0.53
301 0.56
302 0.61
303 0.64