Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N5Q3F1

Protein Details
Accession A0A5N5Q3F1    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
82-107VGLKQRGKGAPKKKKAPPSAKGKTSWHydrophilic
NLS Segment(s)
PositionSequence
85-116KQRGKGAPKKKKAPPSAKGKTSWYNDLKNKKK
Subcellular Location(s) mito 15.5, cyto_mito 10, nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR013219  Ribosomal_S27/S33_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08293  MRP-S33  
Amino Acid Sequences MSVPRARILDLMKVRCQVFSTTYNPEGIRTGNKILRQRLRGPALASYYPRKMSTVQDMVKAFAPYELLVDREEEDERLDHIVGLKQRGKGAPKKKKAPPSAKGKTSWYNDLKNKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.39
3 0.39
4 0.32
5 0.28
6 0.28
7 0.29
8 0.3
9 0.31
10 0.33
11 0.32
12 0.3
13 0.27
14 0.24
15 0.23
16 0.2
17 0.24
18 0.25
19 0.3
20 0.35
21 0.42
22 0.48
23 0.49
24 0.51
25 0.54
26 0.54
27 0.51
28 0.46
29 0.41
30 0.38
31 0.34
32 0.32
33 0.28
34 0.26
35 0.26
36 0.25
37 0.23
38 0.21
39 0.21
40 0.25
41 0.29
42 0.27
43 0.3
44 0.3
45 0.3
46 0.29
47 0.27
48 0.2
49 0.12
50 0.12
51 0.07
52 0.08
53 0.08
54 0.07
55 0.07
56 0.08
57 0.08
58 0.09
59 0.1
60 0.09
61 0.09
62 0.09
63 0.09
64 0.1
65 0.09
66 0.08
67 0.09
68 0.12
69 0.14
70 0.19
71 0.22
72 0.23
73 0.26
74 0.29
75 0.35
76 0.41
77 0.5
78 0.55
79 0.61
80 0.69
81 0.75
82 0.81
83 0.85
84 0.86
85 0.84
86 0.85
87 0.85
88 0.81
89 0.76
90 0.73
91 0.71
92 0.67
93 0.67
94 0.63
95 0.63
96 0.66