Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q752F2

Protein Details
Accession Q752F2    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
295-318YIEVYRRKGSKKSRVVKRVRGGVAHydrophilic
330-351DTTGTPSPSPKPKQRKARSNKHHydrophilic
NLS Segment(s)
PositionSequence
300-314RRKGSKKSRVVKRVR
339-351PKPKQRKARSNKH
Subcellular Location(s) plas 20, E.R. 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR030457  ELO_CS  
IPR002076  ELO_fam  
Gene Ontology GO:0016020  C:membrane  
GO:0009922  F:fatty acid elongase activity  
GO:0102756  F:very-long-chain 3-ketoacyl-CoA synthase activity  
GO:0034625  P:fatty acid elongation, monounsaturated fatty acid  
GO:0034626  P:fatty acid elongation, polyunsaturated fatty acid  
GO:0019367  P:fatty acid elongation, saturated fatty acid  
GO:0030148  P:sphingolipid biosynthetic process  
GO:0042761  P:very long-chain fatty acid biosynthetic process  
KEGG ago:AGOS_AFR624W  -  
Pfam View protein in Pfam  
PF01151  ELO  
PROSITE View protein in PROSITE  
PS01188  ELO  
Amino Acid Sequences MLSVMKESLAKVLDQYPVLEDYVPTLDRPFMNISLWDHFDKSVAWLSNGKFVPHEFHFIPGQLPLSELPQVLAAIATYYVVIFGGRALLQKSEPFKLNVLFQLHNLFLTTVSLGILLLMVEQLVPILARHGLFYAICNIGAWTQPMVTLYYMNYIVKYIEFIDTVFLVLKHKKLTFLHTYHHGATALLCYTQLMGTTSISWVPITLNLAVHVVMYWYYFLAARGIRVWWKEWVTRFQIIQFVLDIGFIYFATYTKLAYDYFPQLLHCGNCVGSAAATFSGCAIISSYLFLFIAFYIEVYRRKGSKKSRVVKRVRGGVAAKVNEYVNIDVDTTGTPSPSPKPKQRKARSNKH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.21
3 0.2
4 0.2
5 0.21
6 0.19
7 0.15
8 0.14
9 0.17
10 0.17
11 0.15
12 0.15
13 0.18
14 0.17
15 0.21
16 0.22
17 0.2
18 0.2
19 0.23
20 0.25
21 0.26
22 0.3
23 0.28
24 0.25
25 0.24
26 0.23
27 0.21
28 0.2
29 0.23
30 0.2
31 0.2
32 0.24
33 0.25
34 0.33
35 0.33
36 0.31
37 0.26
38 0.26
39 0.29
40 0.26
41 0.31
42 0.23
43 0.26
44 0.27
45 0.26
46 0.25
47 0.21
48 0.21
49 0.14
50 0.15
51 0.13
52 0.13
53 0.14
54 0.13
55 0.12
56 0.11
57 0.11
58 0.09
59 0.09
60 0.06
61 0.05
62 0.05
63 0.05
64 0.04
65 0.04
66 0.04
67 0.04
68 0.04
69 0.03
70 0.03
71 0.05
72 0.05
73 0.07
74 0.08
75 0.09
76 0.1
77 0.15
78 0.18
79 0.21
80 0.22
81 0.23
82 0.24
83 0.24
84 0.26
85 0.27
86 0.27
87 0.24
88 0.23
89 0.25
90 0.22
91 0.21
92 0.19
93 0.14
94 0.1
95 0.1
96 0.09
97 0.06
98 0.05
99 0.05
100 0.05
101 0.04
102 0.04
103 0.03
104 0.03
105 0.03
106 0.02
107 0.02
108 0.02
109 0.02
110 0.02
111 0.02
112 0.02
113 0.03
114 0.05
115 0.05
116 0.05
117 0.06
118 0.07
119 0.07
120 0.08
121 0.1
122 0.09
123 0.09
124 0.09
125 0.09
126 0.09
127 0.09
128 0.09
129 0.06
130 0.06
131 0.06
132 0.07
133 0.08
134 0.07
135 0.07
136 0.07
137 0.08
138 0.09
139 0.09
140 0.09
141 0.08
142 0.08
143 0.07
144 0.08
145 0.07
146 0.07
147 0.07
148 0.07
149 0.07
150 0.07
151 0.07
152 0.07
153 0.06
154 0.08
155 0.09
156 0.1
157 0.13
158 0.13
159 0.17
160 0.18
161 0.23
162 0.28
163 0.29
164 0.3
165 0.32
166 0.34
167 0.31
168 0.31
169 0.25
170 0.18
171 0.16
172 0.15
173 0.1
174 0.07
175 0.06
176 0.05
177 0.05
178 0.05
179 0.05
180 0.05
181 0.06
182 0.06
183 0.06
184 0.07
185 0.07
186 0.07
187 0.07
188 0.06
189 0.05
190 0.06
191 0.07
192 0.07
193 0.07
194 0.07
195 0.08
196 0.08
197 0.07
198 0.06
199 0.05
200 0.04
201 0.04
202 0.04
203 0.04
204 0.04
205 0.05
206 0.05
207 0.07
208 0.07
209 0.08
210 0.09
211 0.1
212 0.13
213 0.14
214 0.15
215 0.17
216 0.2
217 0.24
218 0.26
219 0.31
220 0.33
221 0.35
222 0.34
223 0.31
224 0.32
225 0.28
226 0.26
227 0.2
228 0.15
229 0.12
230 0.11
231 0.1
232 0.05
233 0.06
234 0.05
235 0.05
236 0.05
237 0.05
238 0.07
239 0.07
240 0.07
241 0.08
242 0.09
243 0.09
244 0.1
245 0.14
246 0.16
247 0.17
248 0.17
249 0.17
250 0.17
251 0.19
252 0.19
253 0.16
254 0.13
255 0.12
256 0.11
257 0.12
258 0.11
259 0.08
260 0.07
261 0.08
262 0.07
263 0.07
264 0.07
265 0.06
266 0.06
267 0.06
268 0.06
269 0.06
270 0.07
271 0.07
272 0.08
273 0.08
274 0.08
275 0.08
276 0.08
277 0.07
278 0.06
279 0.08
280 0.06
281 0.07
282 0.08
283 0.12
284 0.15
285 0.18
286 0.23
287 0.26
288 0.31
289 0.4
290 0.49
291 0.56
292 0.64
293 0.7
294 0.77
295 0.83
296 0.88
297 0.9
298 0.88
299 0.87
300 0.78
301 0.75
302 0.66
303 0.63
304 0.61
305 0.53
306 0.45
307 0.38
308 0.35
309 0.3
310 0.3
311 0.24
312 0.17
313 0.16
314 0.16
315 0.13
316 0.14
317 0.13
318 0.13
319 0.12
320 0.11
321 0.11
322 0.14
323 0.21
324 0.3
325 0.39
326 0.47
327 0.57
328 0.67
329 0.78
330 0.86
331 0.89