Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N5K764

Protein Details
Accession A0A5N5K764    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
27-53KVKLRLPVKRRVVRRARARAKVRRAARBasic
78-100SLPQERVRSKRRKRKMMASPTGSHydrophilic
NLS Segment(s)
PositionSequence
12-92PGMAKLPPALARARVKVKLRLPVKRRVVRRARARAKVRRAARLLLPASLREARARAARSNKPKTARSLPQERVRSKRRKRK
Subcellular Location(s) mito 20, nucl 6.5, cyto_nucl 4
Family & Domain DBs
Amino Acid Sequences MVRERVVRSSRPGMAKLPPALARARVKVKLRLPVKRRVVRRARARAKVRRAARLLLPASLREARARAARSNKPKTARSLPQERVRSKRRKRKMMASPTGSRTTSPASTDSAPPTPAVSSLARSPLGWPASRPVASAAARFAGLSCRSRSSPRLDIDIFNTSRHNNCMSGQLINIAHSFSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.5
3 0.45
4 0.43
5 0.39
6 0.37
7 0.37
8 0.4
9 0.39
10 0.39
11 0.43
12 0.45
13 0.47
14 0.53
15 0.56
16 0.58
17 0.61
18 0.65
19 0.63
20 0.67
21 0.72
22 0.72
23 0.73
24 0.75
25 0.77
26 0.76
27 0.82
28 0.83
29 0.82
30 0.84
31 0.87
32 0.86
33 0.85
34 0.85
35 0.79
36 0.77
37 0.7
38 0.64
39 0.57
40 0.55
41 0.47
42 0.41
43 0.36
44 0.28
45 0.29
46 0.27
47 0.24
48 0.17
49 0.17
50 0.16
51 0.2
52 0.22
53 0.24
54 0.31
55 0.38
56 0.47
57 0.54
58 0.57
59 0.58
60 0.59
61 0.6
62 0.6
63 0.59
64 0.56
65 0.57
66 0.58
67 0.61
68 0.66
69 0.64
70 0.64
71 0.66
72 0.7
73 0.71
74 0.75
75 0.76
76 0.79
77 0.8
78 0.82
79 0.83
80 0.83
81 0.81
82 0.77
83 0.72
84 0.65
85 0.63
86 0.53
87 0.42
88 0.33
89 0.28
90 0.22
91 0.19
92 0.16
93 0.15
94 0.17
95 0.19
96 0.2
97 0.18
98 0.17
99 0.16
100 0.15
101 0.13
102 0.12
103 0.13
104 0.11
105 0.11
106 0.12
107 0.15
108 0.14
109 0.14
110 0.15
111 0.18
112 0.2
113 0.18
114 0.18
115 0.19
116 0.24
117 0.24
118 0.23
119 0.2
120 0.23
121 0.23
122 0.24
123 0.21
124 0.16
125 0.16
126 0.16
127 0.14
128 0.13
129 0.16
130 0.18
131 0.19
132 0.23
133 0.25
134 0.3
135 0.34
136 0.37
137 0.41
138 0.41
139 0.46
140 0.44
141 0.44
142 0.43
143 0.47
144 0.4
145 0.34
146 0.34
147 0.3
148 0.31
149 0.32
150 0.3
151 0.24
152 0.24
153 0.29
154 0.28
155 0.26
156 0.24
157 0.26
158 0.24
159 0.24
160 0.23