Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N5JHM7

Protein Details
Accession A0A5N5JHM7    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
55-82NRSGRIEKSIRRYRKRMRAVIREFDRRFBasic
NLS Segment(s)
PositionSequence
62-72KSIRRYRKRMR
Subcellular Location(s) nucl 12, cyto_nucl 11.833, cyto 9.5, cyto_mito 7.166, mito 3.5
Family & Domain DBs
Amino Acid Sequences MASVHSFCSNQAELGSVSSTTRITAPRYPGLDDGDLERLRILLLFTRRVLSQVSNRSGRIEKSIRRYRKRMRAVIREFDRRFYGRE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.11
4 0.1
5 0.11
6 0.1
7 0.09
8 0.11
9 0.12
10 0.15
11 0.19
12 0.24
13 0.28
14 0.29
15 0.31
16 0.3
17 0.31
18 0.27
19 0.23
20 0.2
21 0.21
22 0.19
23 0.17
24 0.15
25 0.12
26 0.11
27 0.11
28 0.1
29 0.07
30 0.1
31 0.12
32 0.12
33 0.13
34 0.13
35 0.14
36 0.15
37 0.15
38 0.19
39 0.25
40 0.3
41 0.31
42 0.32
43 0.34
44 0.35
45 0.33
46 0.34
47 0.34
48 0.35
49 0.43
50 0.52
51 0.59
52 0.66
53 0.75
54 0.78
55 0.81
56 0.85
57 0.85
58 0.85
59 0.86
60 0.85
61 0.86
62 0.83
63 0.83
64 0.75
65 0.69
66 0.65