Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N5LW53

Protein Details
Accession A0A5N5LW53    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
56-84IPPGLKDKKNNNRYPKKYNNKEKVPKTNAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 10.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016191  Ribonuclease/ribotoxin  
Gene Ontology GO:0003723  F:RNA binding  
GO:0004540  F:RNA nuclease activity  
Amino Acid Sequences MGCGSSKGEALPQPKPVPKKLEAYRVERHPTNDAIPGVTYRRASSIQRHIDAAPPIPPGLKDKKNNNRYPKKYNNKEKVPKTNAEIQLFHVDTSLTLYEYPSKTFPYDKQNYKGGIYGMTAEQSRREKGHTRTITDRNKTIKGVIYHPQGDPKGFNRAQEIYS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.5
3 0.52
4 0.54
5 0.54
6 0.6
7 0.59
8 0.63
9 0.63
10 0.64
11 0.65
12 0.66
13 0.68
14 0.61
15 0.58
16 0.52
17 0.48
18 0.43
19 0.4
20 0.32
21 0.26
22 0.24
23 0.22
24 0.21
25 0.21
26 0.2
27 0.15
28 0.18
29 0.2
30 0.22
31 0.28
32 0.35
33 0.39
34 0.39
35 0.41
36 0.38
37 0.4
38 0.38
39 0.32
40 0.24
41 0.18
42 0.17
43 0.15
44 0.15
45 0.16
46 0.22
47 0.29
48 0.33
49 0.43
50 0.54
51 0.63
52 0.71
53 0.77
54 0.8
55 0.8
56 0.83
57 0.83
58 0.83
59 0.84
60 0.86
61 0.85
62 0.84
63 0.87
64 0.84
65 0.84
66 0.78
67 0.7
68 0.62
69 0.61
70 0.56
71 0.49
72 0.42
73 0.34
74 0.34
75 0.32
76 0.28
77 0.2
78 0.14
79 0.12
80 0.13
81 0.11
82 0.06
83 0.06
84 0.07
85 0.11
86 0.12
87 0.13
88 0.13
89 0.14
90 0.15
91 0.18
92 0.22
93 0.28
94 0.35
95 0.4
96 0.43
97 0.47
98 0.47
99 0.46
100 0.43
101 0.34
102 0.26
103 0.21
104 0.18
105 0.13
106 0.13
107 0.12
108 0.11
109 0.16
110 0.18
111 0.21
112 0.21
113 0.25
114 0.31
115 0.36
116 0.47
117 0.47
118 0.5
119 0.55
120 0.64
121 0.69
122 0.67
123 0.68
124 0.63
125 0.61
126 0.57
127 0.52
128 0.48
129 0.42
130 0.41
131 0.42
132 0.43
133 0.42
134 0.42
135 0.46
136 0.42
137 0.41
138 0.4
139 0.36
140 0.39
141 0.37
142 0.38
143 0.37