Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N5MXI9

Protein Details
Accession A0A5N5MXI9    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
81-107TPEPGQGEKKQTKKRKSWGQVLPEPKTHydrophilic
NLS Segment(s)
PositionSequence
89-144KKQTKKRKSWGQVLPEPKTNLPPRKRAKTEDEKEQRRVERVLRNRRAAQSSRERKR
Subcellular Location(s) nucl 25.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR046347  bZIP_sf  
IPR044280  Hac1/HY5  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
GO:0006986  P:response to unfolded protein  
Pfam View protein in Pfam  
PF07716  bZIP_2  
PROSITE View protein in PROSITE  
PS50217  BZIP  
CDD cd14710  bZIP_HAC1-like  
Amino Acid Sequences MDGMNHFSYGTPEPTVKFEPSPAESVMSTPSGEYPSLFANSPMPSTMNPRDIMTPESTHDDDFHNDNASQSANDRSGVSQTPEPGQGEKKQTKKRKSWGQVLPEPKTNLPPRKRAKTEDEKEQRRVERVLRNRRAAQSSRERKRQEVEALEKTNQELRDQLAQANRIIQQLVQKVGETPSSTTLDALRPNPLTFSQELFNSQDGHMAPQPSSTASSLMDGILMNSQSSNTVNPASLSPSLLPVPEQDEDDWLAQNESSNTAPLAPVVPRTAQAATEETSPDATQLPAAKLCSSDLQSSALSLPDALLDSSVFDNLGVSAATPTGGYVDESGLLSSPDASHFEYDHLAGDDAAASFFSGGNSQYDHFDITEFLTDDITPLPNQAQQPNNGLDSRGAGLAGGHQLSLPGLATQDSSTDPFLQPPSGASLEGCDVGGIAIGSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.31
3 0.31
4 0.29
5 0.3
6 0.33
7 0.34
8 0.36
9 0.32
10 0.3
11 0.27
12 0.26
13 0.26
14 0.21
15 0.17
16 0.14
17 0.15
18 0.15
19 0.15
20 0.15
21 0.13
22 0.15
23 0.17
24 0.17
25 0.16
26 0.18
27 0.19
28 0.19
29 0.19
30 0.17
31 0.17
32 0.25
33 0.3
34 0.3
35 0.3
36 0.31
37 0.33
38 0.33
39 0.36
40 0.32
41 0.27
42 0.25
43 0.3
44 0.3
45 0.27
46 0.27
47 0.25
48 0.24
49 0.25
50 0.24
51 0.21
52 0.2
53 0.2
54 0.2
55 0.18
56 0.16
57 0.15
58 0.17
59 0.15
60 0.16
61 0.16
62 0.16
63 0.19
64 0.2
65 0.22
66 0.21
67 0.22
68 0.23
69 0.26
70 0.26
71 0.26
72 0.28
73 0.31
74 0.38
75 0.44
76 0.51
77 0.58
78 0.67
79 0.74
80 0.79
81 0.83
82 0.84
83 0.85
84 0.86
85 0.84
86 0.84
87 0.82
88 0.81
89 0.75
90 0.7
91 0.63
92 0.54
93 0.54
94 0.53
95 0.55
96 0.53
97 0.59
98 0.63
99 0.7
100 0.75
101 0.73
102 0.74
103 0.75
104 0.75
105 0.76
106 0.77
107 0.74
108 0.74
109 0.75
110 0.68
111 0.61
112 0.59
113 0.55
114 0.55
115 0.58
116 0.63
117 0.64
118 0.67
119 0.69
120 0.7
121 0.7
122 0.63
123 0.62
124 0.62
125 0.64
126 0.66
127 0.7
128 0.67
129 0.64
130 0.64
131 0.62
132 0.58
133 0.55
134 0.54
135 0.52
136 0.53
137 0.5
138 0.46
139 0.41
140 0.38
141 0.3
142 0.24
143 0.17
144 0.16
145 0.2
146 0.21
147 0.22
148 0.21
149 0.22
150 0.22
151 0.24
152 0.23
153 0.18
154 0.17
155 0.16
156 0.17
157 0.18
158 0.2
159 0.17
160 0.16
161 0.16
162 0.17
163 0.17
164 0.13
165 0.12
166 0.13
167 0.15
168 0.15
169 0.14
170 0.15
171 0.15
172 0.17
173 0.17
174 0.17
175 0.17
176 0.16
177 0.17
178 0.17
179 0.17
180 0.15
181 0.16
182 0.14
183 0.13
184 0.15
185 0.16
186 0.16
187 0.14
188 0.13
189 0.15
190 0.14
191 0.16
192 0.15
193 0.14
194 0.13
195 0.12
196 0.12
197 0.1
198 0.11
199 0.09
200 0.08
201 0.08
202 0.08
203 0.08
204 0.08
205 0.08
206 0.06
207 0.06
208 0.06
209 0.06
210 0.05
211 0.05
212 0.05
213 0.05
214 0.06
215 0.06
216 0.06
217 0.07
218 0.07
219 0.08
220 0.08
221 0.1
222 0.1
223 0.1
224 0.09
225 0.1
226 0.1
227 0.1
228 0.09
229 0.07
230 0.1
231 0.1
232 0.11
233 0.1
234 0.11
235 0.12
236 0.12
237 0.12
238 0.09
239 0.09
240 0.08
241 0.09
242 0.08
243 0.08
244 0.08
245 0.08
246 0.07
247 0.07
248 0.07
249 0.07
250 0.08
251 0.06
252 0.08
253 0.09
254 0.09
255 0.09
256 0.12
257 0.12
258 0.11
259 0.12
260 0.13
261 0.12
262 0.13
263 0.13
264 0.11
265 0.12
266 0.11
267 0.1
268 0.09
269 0.08
270 0.08
271 0.1
272 0.11
273 0.12
274 0.13
275 0.12
276 0.12
277 0.13
278 0.15
279 0.15
280 0.15
281 0.14
282 0.15
283 0.15
284 0.15
285 0.15
286 0.12
287 0.1
288 0.08
289 0.07
290 0.06
291 0.06
292 0.05
293 0.05
294 0.05
295 0.06
296 0.06
297 0.06
298 0.06
299 0.05
300 0.05
301 0.05
302 0.06
303 0.04
304 0.04
305 0.04
306 0.04
307 0.05
308 0.04
309 0.04
310 0.05
311 0.05
312 0.05
313 0.06
314 0.06
315 0.07
316 0.07
317 0.07
318 0.07
319 0.07
320 0.06
321 0.06
322 0.06
323 0.07
324 0.09
325 0.1
326 0.11
327 0.12
328 0.13
329 0.14
330 0.14
331 0.14
332 0.13
333 0.12
334 0.1
335 0.1
336 0.09
337 0.08
338 0.08
339 0.06
340 0.05
341 0.05
342 0.05
343 0.06
344 0.06
345 0.07
346 0.08
347 0.09
348 0.1
349 0.12
350 0.13
351 0.13
352 0.13
353 0.12
354 0.12
355 0.12
356 0.14
357 0.13
358 0.12
359 0.12
360 0.12
361 0.12
362 0.13
363 0.13
364 0.1
365 0.11
366 0.12
367 0.16
368 0.19
369 0.25
370 0.28
371 0.3
372 0.35
373 0.37
374 0.38
375 0.35
376 0.32
377 0.26
378 0.24
379 0.22
380 0.17
381 0.14
382 0.11
383 0.1
384 0.11
385 0.14
386 0.12
387 0.1
388 0.1
389 0.1
390 0.1
391 0.11
392 0.09
393 0.06
394 0.06
395 0.07
396 0.08
397 0.08
398 0.1
399 0.11
400 0.13
401 0.15
402 0.18
403 0.18
404 0.2
405 0.22
406 0.22
407 0.21
408 0.2
409 0.23
410 0.21
411 0.21
412 0.17
413 0.18
414 0.18
415 0.18
416 0.17
417 0.11
418 0.1
419 0.09
420 0.1