Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5E320

Protein Details
Accession C5E320    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
3-30EQITHKRPIRIKIDKDKRKQLQDFYKLRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, cyto_nucl 12.5, cyto 5, mito 3
Family & Domain DBs
KEGG lth:KLTH0H09614g  -  
Pfam View protein in Pfam  
PF08700  Vps51  
Amino Acid Sequences MAEQITHKRPIRIKIDKDKRKQLQDFYKLREEQSPVSDNINENHESVDQDVASASEDCVEPPTLKISESTLSELVSAHNTLLGKETEVNNTIKNTIYENYYDLIKVNELLKSVGNDSSDRLAQLSDILKLLEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.8
3 0.83
4 0.86
5 0.89
6 0.87
7 0.87
8 0.84
9 0.82
10 0.82
11 0.82
12 0.8
13 0.75
14 0.75
15 0.66
16 0.61
17 0.56
18 0.49
19 0.41
20 0.39
21 0.36
22 0.29
23 0.3
24 0.3
25 0.26
26 0.24
27 0.25
28 0.2
29 0.17
30 0.17
31 0.15
32 0.14
33 0.13
34 0.13
35 0.09
36 0.08
37 0.08
38 0.06
39 0.07
40 0.07
41 0.06
42 0.06
43 0.06
44 0.06
45 0.07
46 0.08
47 0.07
48 0.07
49 0.1
50 0.09
51 0.09
52 0.1
53 0.1
54 0.11
55 0.12
56 0.13
57 0.11
58 0.11
59 0.11
60 0.1
61 0.09
62 0.09
63 0.08
64 0.06
65 0.07
66 0.07
67 0.07
68 0.09
69 0.09
70 0.08
71 0.11
72 0.12
73 0.13
74 0.15
75 0.16
76 0.16
77 0.17
78 0.17
79 0.15
80 0.15
81 0.15
82 0.14
83 0.15
84 0.14
85 0.15
86 0.15
87 0.14
88 0.14
89 0.12
90 0.12
91 0.1
92 0.11
93 0.11
94 0.12
95 0.12
96 0.13
97 0.14
98 0.15
99 0.16
100 0.16
101 0.17
102 0.16
103 0.18
104 0.2
105 0.19
106 0.18
107 0.17
108 0.14
109 0.13
110 0.16
111 0.16
112 0.14
113 0.13