Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N5M8R6

Protein Details
Accession A0A5N5M8R6    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
12-36SLYRSCLRASRKKPKETRPHFEKYAHydrophilic
NLS Segment(s)
PositionSequence
23-24KK
Subcellular Location(s) mito 22, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR008011  Complex1_LYR_dom  
IPR045295  Complex1_LYR_SDHAF1_LYRM8  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0034553  P:mitochondrial respiratory chain complex II assembly  
Pfam View protein in Pfam  
PF05347  Complex1_LYR  
CDD cd20268  Complex1_LYR_SDHAF1_LYRM8  
Amino Acid Sequences MRLSGLQREVLSLYRSCLRASRKKPKETRPHFEKYARTEFEKNIHINKKDFAAVEFLVRKGKRQLEVYSSPGIKDIR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.22
3 0.22
4 0.26
5 0.32
6 0.39
7 0.49
8 0.57
9 0.62
10 0.71
11 0.79
12 0.84
13 0.87
14 0.86
15 0.86
16 0.82
17 0.8
18 0.76
19 0.72
20 0.67
21 0.63
22 0.62
23 0.54
24 0.5
25 0.45
26 0.41
27 0.39
28 0.38
29 0.33
30 0.33
31 0.37
32 0.36
33 0.35
34 0.35
35 0.33
36 0.3
37 0.28
38 0.21
39 0.19
40 0.16
41 0.19
42 0.2
43 0.19
44 0.24
45 0.24
46 0.26
47 0.3
48 0.35
49 0.36
50 0.39
51 0.43
52 0.44
53 0.49
54 0.5
55 0.5
56 0.45
57 0.4