Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q74ZA7

Protein Details
Accession Q74ZA7    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
14-41ADGARRVDKKAGRRRKRERCQFGKCVSSBasic
66-87HTCRGLRTCKEHMRRRNADKLAHydrophilic
NLS Segment(s)
PositionSequence
17-31ARRVDKKAGRRRKRE
Subcellular Location(s) nucl 13.5, cyto_nucl 12.5, cyto 10.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR035896  AN1-like_Znf  
IPR000058  Znf_AN1  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0008270  F:zinc ion binding  
GO:0071243  P:cellular response to arsenic-containing substance  
GO:0071218  P:cellular response to misfolded protein  
KEGG ago:AGOS_AGR296W  -  
Pfam View protein in Pfam  
PF01428  zf-AN1  
PROSITE View protein in PROSITE  
PS51039  ZF_AN1  
Amino Acid Sequences MTDGVTAPAERPAADGARRVDKKAGRRRKRERCQFGKCVSSALKFIGECQFCDGQFCSRHRLMENHTCRGLRTCKEHMRRRNADKLAQEQTVVAKIQI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.22
3 0.23
4 0.33
5 0.34
6 0.35
7 0.39
8 0.41
9 0.5
10 0.56
11 0.63
12 0.64
13 0.73
14 0.82
15 0.86
16 0.92
17 0.93
18 0.93
19 0.92
20 0.91
21 0.88
22 0.82
23 0.75
24 0.64
25 0.57
26 0.48
27 0.39
28 0.31
29 0.23
30 0.2
31 0.15
32 0.16
33 0.19
34 0.17
35 0.16
36 0.18
37 0.18
38 0.16
39 0.18
40 0.17
41 0.15
42 0.2
43 0.21
44 0.24
45 0.24
46 0.27
47 0.27
48 0.3
49 0.33
50 0.38
51 0.43
52 0.41
53 0.43
54 0.41
55 0.4
56 0.42
57 0.42
58 0.36
59 0.37
60 0.42
61 0.49
62 0.59
63 0.68
64 0.72
65 0.76
66 0.81
67 0.82
68 0.83
69 0.79
70 0.76
71 0.73
72 0.71
73 0.66
74 0.57
75 0.49
76 0.4
77 0.37
78 0.33