Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5DG39

Protein Details
Accession C5DG39    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
266-291FTSGKGKKGTSAARKKRPRVEIEYEEHydrophilic
NLS Segment(s)
PositionSequence
141-152VKRRDENRERKA
270-284KGKKGTSAARKKRPR
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029004  L28e/Mak16  
IPR006958  Mak16  
Gene Ontology GO:0005730  C:nucleolus  
KEGG lth:KLTH0D02178g  -  
Pfam View protein in Pfam  
PF04874  Mak16  
PF01778  Ribosomal_L28e  
Amino Acid Sequences MSDEIIWQVINQHFCAYKLKTDKGQNFCRNEYNVTGLCNRQSCPLANAKYATVKNVDGRLYLYMKTAERAHTPAKMWERIRLSKNYAKALKQVDDHLLYWNKFLIHKCKQRLTRLTQVAVTERRMELREEERHYVGIAPKVKRRDENRERKALAAAKIEKAIEKELLDRLKSGAYGDKPLNVDEKIWRKVLGHVEDEQEDDEEEYDDEEEDESDAEIEYVEDDGDEELVDVEDIERWLDDPEASDSDSFEEDEMSDSSEDEPESGFTSGKGKKGTSAARKKRPRVEIEYEEETQPAHRELAH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.31
3 0.28
4 0.32
5 0.38
6 0.42
7 0.47
8 0.56
9 0.64
10 0.66
11 0.74
12 0.74
13 0.73
14 0.72
15 0.71
16 0.64
17 0.59
18 0.52
19 0.47
20 0.4
21 0.37
22 0.36
23 0.32
24 0.33
25 0.32
26 0.3
27 0.29
28 0.3
29 0.29
30 0.3
31 0.36
32 0.35
33 0.36
34 0.36
35 0.34
36 0.38
37 0.37
38 0.35
39 0.29
40 0.28
41 0.29
42 0.31
43 0.3
44 0.23
45 0.24
46 0.25
47 0.24
48 0.22
49 0.2
50 0.19
51 0.19
52 0.21
53 0.22
54 0.21
55 0.22
56 0.26
57 0.27
58 0.27
59 0.28
60 0.33
61 0.36
62 0.41
63 0.39
64 0.42
65 0.47
66 0.5
67 0.54
68 0.52
69 0.53
70 0.51
71 0.54
72 0.56
73 0.53
74 0.48
75 0.49
76 0.48
77 0.44
78 0.4
79 0.38
80 0.34
81 0.31
82 0.3
83 0.3
84 0.3
85 0.27
86 0.26
87 0.24
88 0.21
89 0.22
90 0.25
91 0.28
92 0.32
93 0.4
94 0.46
95 0.53
96 0.59
97 0.65
98 0.69
99 0.67
100 0.68
101 0.64
102 0.59
103 0.53
104 0.48
105 0.44
106 0.38
107 0.33
108 0.25
109 0.2
110 0.21
111 0.2
112 0.19
113 0.18
114 0.22
115 0.27
116 0.29
117 0.31
118 0.3
119 0.29
120 0.28
121 0.27
122 0.22
123 0.21
124 0.23
125 0.23
126 0.27
127 0.32
128 0.34
129 0.38
130 0.42
131 0.48
132 0.53
133 0.62
134 0.64
135 0.67
136 0.65
137 0.6
138 0.58
139 0.51
140 0.43
141 0.38
142 0.33
143 0.26
144 0.27
145 0.26
146 0.23
147 0.19
148 0.18
149 0.13
150 0.11
151 0.12
152 0.15
153 0.16
154 0.16
155 0.15
156 0.15
157 0.14
158 0.13
159 0.12
160 0.13
161 0.12
162 0.16
163 0.16
164 0.18
165 0.18
166 0.19
167 0.2
168 0.16
169 0.17
170 0.19
171 0.26
172 0.26
173 0.26
174 0.26
175 0.24
176 0.29
177 0.36
178 0.33
179 0.28
180 0.28
181 0.29
182 0.28
183 0.28
184 0.23
185 0.16
186 0.13
187 0.1
188 0.08
189 0.07
190 0.06
191 0.06
192 0.06
193 0.06
194 0.06
195 0.06
196 0.06
197 0.05
198 0.05
199 0.05
200 0.05
201 0.05
202 0.04
203 0.04
204 0.04
205 0.04
206 0.04
207 0.04
208 0.03
209 0.04
210 0.04
211 0.04
212 0.04
213 0.04
214 0.04
215 0.04
216 0.04
217 0.04
218 0.04
219 0.05
220 0.05
221 0.05
222 0.05
223 0.06
224 0.07
225 0.07
226 0.07
227 0.08
228 0.11
229 0.12
230 0.13
231 0.13
232 0.13
233 0.14
234 0.14
235 0.13
236 0.1
237 0.09
238 0.08
239 0.1
240 0.1
241 0.1
242 0.09
243 0.1
244 0.11
245 0.11
246 0.11
247 0.09
248 0.1
249 0.09
250 0.11
251 0.11
252 0.1
253 0.1
254 0.17
255 0.21
256 0.25
257 0.27
258 0.26
259 0.29
260 0.37
261 0.46
262 0.49
263 0.57
264 0.63
265 0.71
266 0.81
267 0.86
268 0.88
269 0.88
270 0.86
271 0.83
272 0.82
273 0.79
274 0.76
275 0.73
276 0.66
277 0.57
278 0.49
279 0.4
280 0.32
281 0.27
282 0.22