Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N5JIC1

Protein Details
Accession A0A5N5JIC1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
56-78SQSSTYCVGRRKRRRNSETMAAAHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 16, extr 5, E.R. 5
Family & Domain DBs
Amino Acid Sequences MVVATGLFLKLACFCFVLMSTGVVNTRTIRKGGPQLLILLHDVAGSAWWNPFRPASQSSTYCVGRRKRRRNSETMAAADTTPGPLNFPSNSHPSPSVHLVC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.13
4 0.14
5 0.12
6 0.11
7 0.1
8 0.11
9 0.12
10 0.11
11 0.12
12 0.12
13 0.16
14 0.16
15 0.17
16 0.17
17 0.2
18 0.27
19 0.3
20 0.31
21 0.27
22 0.26
23 0.26
24 0.26
25 0.22
26 0.15
27 0.11
28 0.08
29 0.07
30 0.05
31 0.05
32 0.04
33 0.04
34 0.05
35 0.06
36 0.06
37 0.07
38 0.08
39 0.08
40 0.12
41 0.14
42 0.17
43 0.22
44 0.22
45 0.24
46 0.29
47 0.3
48 0.29
49 0.34
50 0.38
51 0.44
52 0.54
53 0.62
54 0.68
55 0.77
56 0.82
57 0.84
58 0.83
59 0.81
60 0.76
61 0.68
62 0.59
63 0.49
64 0.41
65 0.33
66 0.26
67 0.18
68 0.13
69 0.1
70 0.1
71 0.1
72 0.13
73 0.14
74 0.16
75 0.19
76 0.25
77 0.27
78 0.29
79 0.31
80 0.3
81 0.35