Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N5PZ39

Protein Details
Accession A0A5N5PZ39    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
160-189GDDSDKKVRRERSRSHHRHRSGSRHGSHRSBasic
NLS Segment(s)
PositionSequence
165-188KKVRRERSRSHHRHRSGSRHGSHR
Subcellular Location(s) plas 16, mito 5, E.R. 2, golg 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MLFAVFFAFWRFAEIVTLIPLLGMLSYFVDGYNKNNLLTPNYILILFIVSVLSAAWAIFTLFSYHRSSSNARFVGLIDLGFVGALIAGVYYLRFIAGANCSRIIPGDSYDVTFGIFGSAHLNGFSVSVNKTCAMLKACFALGIMNIVFFFFTAVLALLHGDDSDKKVRRERSRSHHRHRSGSRHGSHRSSHSHSRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.13
3 0.14
4 0.14
5 0.1
6 0.09
7 0.09
8 0.07
9 0.06
10 0.05
11 0.04
12 0.04
13 0.05
14 0.05
15 0.06
16 0.08
17 0.08
18 0.11
19 0.18
20 0.19
21 0.19
22 0.22
23 0.23
24 0.25
25 0.27
26 0.26
27 0.2
28 0.19
29 0.19
30 0.16
31 0.15
32 0.12
33 0.09
34 0.07
35 0.05
36 0.04
37 0.04
38 0.04
39 0.04
40 0.03
41 0.03
42 0.03
43 0.03
44 0.03
45 0.03
46 0.04
47 0.06
48 0.07
49 0.1
50 0.13
51 0.14
52 0.15
53 0.19
54 0.22
55 0.25
56 0.33
57 0.3
58 0.27
59 0.27
60 0.26
61 0.25
62 0.21
63 0.16
64 0.08
65 0.07
66 0.06
67 0.06
68 0.05
69 0.03
70 0.02
71 0.02
72 0.02
73 0.02
74 0.02
75 0.02
76 0.02
77 0.02
78 0.02
79 0.02
80 0.02
81 0.03
82 0.04
83 0.07
84 0.09
85 0.1
86 0.11
87 0.11
88 0.11
89 0.11
90 0.11
91 0.09
92 0.08
93 0.1
94 0.09
95 0.1
96 0.1
97 0.1
98 0.09
99 0.08
100 0.07
101 0.05
102 0.04
103 0.04
104 0.05
105 0.06
106 0.06
107 0.06
108 0.06
109 0.06
110 0.06
111 0.06
112 0.06
113 0.07
114 0.08
115 0.09
116 0.09
117 0.1
118 0.1
119 0.13
120 0.15
121 0.15
122 0.15
123 0.15
124 0.15
125 0.14
126 0.14
127 0.11
128 0.08
129 0.09
130 0.08
131 0.06
132 0.06
133 0.06
134 0.06
135 0.05
136 0.06
137 0.04
138 0.04
139 0.04
140 0.04
141 0.04
142 0.05
143 0.05
144 0.05
145 0.05
146 0.05
147 0.06
148 0.06
149 0.1
150 0.19
151 0.24
152 0.28
153 0.36
154 0.46
155 0.55
156 0.64
157 0.7
158 0.73
159 0.79
160 0.86
161 0.9
162 0.91
163 0.88
164 0.88
165 0.88
166 0.87
167 0.86
168 0.85
169 0.82
170 0.8
171 0.8
172 0.75
173 0.71
174 0.68
175 0.65
176 0.63