Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N5KSV3

Protein Details
Accession A0A5N5KSV3    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
26-46IIPAREPRRQHARRRSSAPDIHydrophilic
136-157AGSGRKTGRRTGRRRRRSLDLGBasic
NLS Segment(s)
PositionSequence
139-153GRKTGRRTGRRRRRS
Subcellular Location(s) nucl 16.5, cyto_nucl 13, cyto 6.5, mito 4
Family & Domain DBs
Amino Acid Sequences MRSHPYAAAPPLPPLPDDLATDLSSIIPAREPRRQHARRRSSAPDIPLSDLDPDTSCLLSPAAATATATAASRRLSHHHVRVQGRLALVRSVSTVSVRRRGSPGASGRTSGDSSVPPVPPVARYESAVGSAVGVAAGSGRKTGRRTGRRRRRSLDLGERYREGKSESESEEDERRRRETVSRDMQLRGYGIGGAGNIRRPIDVVHFTPSATTNRMSMLLFSNVPPGSPTSLTSPERKKWNLREIFRLDRRPQGKASS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.26
3 0.23
4 0.24
5 0.23
6 0.23
7 0.22
8 0.22
9 0.19
10 0.15
11 0.14
12 0.13
13 0.1
14 0.11
15 0.17
16 0.22
17 0.29
18 0.33
19 0.4
20 0.51
21 0.59
22 0.66
23 0.71
24 0.77
25 0.78
26 0.82
27 0.81
28 0.79
29 0.76
30 0.7
31 0.66
32 0.57
33 0.52
34 0.45
35 0.39
36 0.32
37 0.26
38 0.22
39 0.16
40 0.16
41 0.14
42 0.13
43 0.12
44 0.1
45 0.1
46 0.09
47 0.08
48 0.07
49 0.06
50 0.06
51 0.06
52 0.06
53 0.06
54 0.07
55 0.07
56 0.07
57 0.08
58 0.09
59 0.1
60 0.12
61 0.16
62 0.22
63 0.29
64 0.37
65 0.4
66 0.47
67 0.49
68 0.51
69 0.5
70 0.45
71 0.39
72 0.33
73 0.28
74 0.22
75 0.18
76 0.15
77 0.12
78 0.11
79 0.1
80 0.1
81 0.15
82 0.17
83 0.24
84 0.25
85 0.26
86 0.28
87 0.29
88 0.29
89 0.3
90 0.33
91 0.32
92 0.32
93 0.31
94 0.29
95 0.3
96 0.28
97 0.21
98 0.17
99 0.11
100 0.13
101 0.16
102 0.15
103 0.12
104 0.13
105 0.13
106 0.13
107 0.14
108 0.16
109 0.13
110 0.14
111 0.15
112 0.15
113 0.15
114 0.14
115 0.12
116 0.08
117 0.07
118 0.06
119 0.04
120 0.03
121 0.03
122 0.02
123 0.03
124 0.03
125 0.04
126 0.05
127 0.08
128 0.1
129 0.17
130 0.26
131 0.36
132 0.47
133 0.57
134 0.68
135 0.76
136 0.83
137 0.82
138 0.8
139 0.77
140 0.76
141 0.76
142 0.75
143 0.7
144 0.64
145 0.6
146 0.53
147 0.46
148 0.38
149 0.29
150 0.21
151 0.18
152 0.19
153 0.2
154 0.21
155 0.22
156 0.24
157 0.28
158 0.31
159 0.33
160 0.32
161 0.32
162 0.31
163 0.32
164 0.35
165 0.36
166 0.41
167 0.46
168 0.48
169 0.49
170 0.49
171 0.48
172 0.43
173 0.36
174 0.26
175 0.17
176 0.12
177 0.09
178 0.08
179 0.07
180 0.07
181 0.08
182 0.1
183 0.12
184 0.12
185 0.12
186 0.12
187 0.13
188 0.17
189 0.21
190 0.2
191 0.23
192 0.23
193 0.23
194 0.24
195 0.25
196 0.23
197 0.2
198 0.2
199 0.15
200 0.17
201 0.18
202 0.17
203 0.16
204 0.17
205 0.17
206 0.17
207 0.17
208 0.22
209 0.2
210 0.2
211 0.19
212 0.18
213 0.18
214 0.18
215 0.2
216 0.2
217 0.27
218 0.3
219 0.38
220 0.43
221 0.47
222 0.55
223 0.6
224 0.64
225 0.66
226 0.74
227 0.76
228 0.74
229 0.77
230 0.76
231 0.8
232 0.79
233 0.79
234 0.72
235 0.72
236 0.71
237 0.65