Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N5L1M8

Protein Details
Accession A0A5N5L1M8    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
93-119EKLAEKMHKKRVERLKRKEKRNKLLNSBasic
NLS Segment(s)
PositionSequence
22-115RKNGKQWHEPKKAFRPASGLTPYEKRAKDRVTMAMVKAKEKEMKDEKEAARKARIETIKAKRAAKEEKERYEKLAEKMHKKRVERLKRKEKRNK
Subcellular Location(s) nucl 18, cyto_nucl 12, mito 5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR005579  Cgr1-like  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF03879  Cgr1  
Amino Acid Sequences MSESAKVEAAPVVAKAAPQGMRKNGKQWHEPKKAFRPASGLTPYEKRAKDRVTMAMVKAKEKEMKDEKEAARKARIETIKAKRAAKEEKERYEKLAEKMHKKRVERLKRKEKRNKLLNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.14
4 0.17
5 0.21
6 0.26
7 0.33
8 0.41
9 0.42
10 0.5
11 0.52
12 0.53
13 0.58
14 0.62
15 0.65
16 0.68
17 0.71
18 0.72
19 0.75
20 0.79
21 0.71
22 0.63
23 0.58
24 0.49
25 0.51
26 0.45
27 0.37
28 0.3
29 0.32
30 0.33
31 0.35
32 0.34
33 0.31
34 0.33
35 0.34
36 0.35
37 0.35
38 0.36
39 0.34
40 0.34
41 0.32
42 0.31
43 0.29
44 0.26
45 0.24
46 0.22
47 0.22
48 0.2
49 0.27
50 0.29
51 0.32
52 0.33
53 0.4
54 0.4
55 0.44
56 0.47
57 0.42
58 0.4
59 0.39
60 0.38
61 0.38
62 0.38
63 0.34
64 0.4
65 0.45
66 0.48
67 0.51
68 0.52
69 0.48
70 0.53
71 0.57
72 0.56
73 0.59
74 0.6
75 0.64
76 0.69
77 0.67
78 0.64
79 0.63
80 0.6
81 0.54
82 0.54
83 0.53
84 0.55
85 0.63
86 0.69
87 0.69
88 0.67
89 0.72
90 0.74
91 0.77
92 0.78
93 0.8
94 0.82
95 0.84
96 0.92
97 0.94
98 0.94
99 0.93