Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N5Q1F3

Protein Details
Accession A0A5N5Q1F3    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MAPANTGAKKQKKKWSKGKVKDKAQHAVLHydrophilic
NLS Segment(s)
PositionSequence
8-23AKKQKKKWSKGKVKDK
Subcellular Location(s) nucl 13, cyto_nucl 10.5, mito 7, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPANTGAKKQKKKWSKGKVKDKAQHAVLLDKATSDKLYKDVQSYRLVTVATLVDRLKVNGSLARKCIKELEEKGLIKPVVTHSKMRIYTRAVTAAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.87
3 0.89
4 0.9
5 0.93
6 0.92
7 0.92
8 0.89
9 0.85
10 0.82
11 0.72
12 0.65
13 0.55
14 0.48
15 0.39
16 0.32
17 0.25
18 0.18
19 0.16
20 0.13
21 0.13
22 0.1
23 0.09
24 0.11
25 0.14
26 0.15
27 0.18
28 0.2
29 0.23
30 0.27
31 0.27
32 0.25
33 0.23
34 0.22
35 0.18
36 0.16
37 0.13
38 0.08
39 0.09
40 0.08
41 0.09
42 0.09
43 0.1
44 0.09
45 0.09
46 0.1
47 0.12
48 0.16
49 0.17
50 0.2
51 0.24
52 0.24
53 0.24
54 0.27
55 0.26
56 0.31
57 0.32
58 0.35
59 0.39
60 0.4
61 0.4
62 0.42
63 0.4
64 0.31
65 0.3
66 0.3
67 0.31
68 0.33
69 0.36
70 0.33
71 0.42
72 0.48
73 0.49
74 0.48
75 0.44
76 0.46
77 0.47