Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N5NTM8

Protein Details
Accession A0A5N5NTM8    Localization Confidence Low Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
42-64CCLPSFKVRWSQRRRPQHRVVSHHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 9, nucl 7, mito 6, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR007527  Znf_SWIM  
Gene Ontology GO:0008270  F:zinc ion binding  
PROSITE View protein in PROSITE  
PS50966  ZF_SWIM  
Amino Acid Sequences MPFLVLISYFDFQLVCSCSHRLLCFFDFTSTCRHPLAMCLLCCLPSFKVRWSQRRRPQHRVVSHAIWHWIFDAMACGLADIALQLVLDPNILTMARFPTFRPPLGRLLFICAIPTTPLRSAGYCRSFEEPRYLHSTSCVDS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.13
3 0.15
4 0.17
5 0.19
6 0.23
7 0.24
8 0.23
9 0.26
10 0.26
11 0.27
12 0.26
13 0.27
14 0.25
15 0.25
16 0.3
17 0.26
18 0.27
19 0.24
20 0.23
21 0.2
22 0.22
23 0.29
24 0.26
25 0.24
26 0.25
27 0.25
28 0.25
29 0.25
30 0.25
31 0.18
32 0.16
33 0.18
34 0.18
35 0.28
36 0.35
37 0.45
38 0.53
39 0.62
40 0.68
41 0.77
42 0.83
43 0.82
44 0.84
45 0.84
46 0.79
47 0.75
48 0.71
49 0.62
50 0.56
51 0.48
52 0.41
53 0.3
54 0.25
55 0.19
56 0.14
57 0.1
58 0.08
59 0.08
60 0.05
61 0.05
62 0.05
63 0.04
64 0.04
65 0.04
66 0.04
67 0.03
68 0.03
69 0.02
70 0.02
71 0.02
72 0.03
73 0.03
74 0.03
75 0.03
76 0.03
77 0.04
78 0.04
79 0.04
80 0.05
81 0.08
82 0.09
83 0.1
84 0.11
85 0.2
86 0.23
87 0.26
88 0.29
89 0.29
90 0.36
91 0.38
92 0.4
93 0.31
94 0.33
95 0.32
96 0.28
97 0.26
98 0.18
99 0.17
100 0.16
101 0.17
102 0.15
103 0.14
104 0.18
105 0.18
106 0.2
107 0.24
108 0.31
109 0.35
110 0.34
111 0.36
112 0.38
113 0.39
114 0.4
115 0.45
116 0.37
117 0.36
118 0.41
119 0.39
120 0.34
121 0.36