Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5DN68

Protein Details
Accession C5DN68    Localization Confidence High Confidence Score 19.7
NoLS Segment(s)
PositionSequenceProtein Nature
6-25KLSQLRKKPATKPGEKTMDKHydrophilic
54-78DPAIRRLKELRRKEQLKNAPKNKPGBasic
NLS Segment(s)
PositionSequence
58-89RRLKELRRKEQLKNAPKNKPGAPSSRKKKDEN
96-118TKFRRKVGQSTKPQRPVAPVRRE
157-220KPIKLNKPGFNKGARRTPAAAPVSKPRERKEPTVKLKQLSIPKSSIAQPGEKLRKKLDSIKKKR
309-312KRRK
Subcellular Location(s) nucl 21.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013256  Chromatin_SPT2  
KEGG lth:KLTH0G14586g  -  
Pfam View protein in Pfam  
PF08243  SPT2  
Amino Acid Sequences MSFLAKLSQLRKKPATKPGEKTMDKSPKPVSGVILDPLRSESSLLPQKYVREEDPAIRRLKELRRKEQLKNAPKNKPGAPSSRKKKDENSATATETKFRRKVGQSTKPQRPVAPVRREPLKKLSFDELMKEAEKKASDPSTDSKAPSAQKATSSIAKPIKLNKPGFNKGARRTPAAAPVSKPRERKEPTVKLKQLSIPKSSIAQPGEKLRKKLDSIKKKRQGEAYGYEDEEDLDDFIEDDEEEEGFNRDEIWAIFNKGKKRRNFENDYDSDDMEANEMEILEEEERATKMARLEDKQEEEWLKRHEQEKRRKFVRP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.76
3 0.77
4 0.78
5 0.79
6 0.81
7 0.75
8 0.7
9 0.71
10 0.71
11 0.63
12 0.62
13 0.57
14 0.52
15 0.53
16 0.51
17 0.43
18 0.36
19 0.36
20 0.35
21 0.33
22 0.28
23 0.25
24 0.25
25 0.23
26 0.2
27 0.19
28 0.15
29 0.21
30 0.29
31 0.29
32 0.29
33 0.3
34 0.33
35 0.37
36 0.41
37 0.34
38 0.32
39 0.34
40 0.39
41 0.44
42 0.47
43 0.45
44 0.41
45 0.42
46 0.43
47 0.5
48 0.53
49 0.55
50 0.59
51 0.66
52 0.73
53 0.78
54 0.81
55 0.81
56 0.82
57 0.83
58 0.82
59 0.8
60 0.78
61 0.77
62 0.7
63 0.67
64 0.62
65 0.61
66 0.6
67 0.62
68 0.67
69 0.72
70 0.73
71 0.71
72 0.73
73 0.73
74 0.75
75 0.71
76 0.68
77 0.6
78 0.58
79 0.57
80 0.5
81 0.45
82 0.39
83 0.4
84 0.36
85 0.34
86 0.39
87 0.4
88 0.49
89 0.54
90 0.61
91 0.64
92 0.71
93 0.79
94 0.79
95 0.76
96 0.68
97 0.64
98 0.65
99 0.64
100 0.64
101 0.59
102 0.55
103 0.62
104 0.63
105 0.59
106 0.58
107 0.53
108 0.45
109 0.43
110 0.43
111 0.39
112 0.37
113 0.36
114 0.28
115 0.25
116 0.24
117 0.22
118 0.18
119 0.16
120 0.16
121 0.14
122 0.16
123 0.16
124 0.16
125 0.18
126 0.2
127 0.24
128 0.25
129 0.25
130 0.22
131 0.24
132 0.24
133 0.24
134 0.24
135 0.19
136 0.19
137 0.21
138 0.22
139 0.22
140 0.21
141 0.25
142 0.25
143 0.26
144 0.26
145 0.3
146 0.35
147 0.39
148 0.41
149 0.41
150 0.46
151 0.49
152 0.52
153 0.52
154 0.51
155 0.48
156 0.53
157 0.49
158 0.44
159 0.42
160 0.4
161 0.41
162 0.38
163 0.35
164 0.29
165 0.35
166 0.39
167 0.41
168 0.44
169 0.38
170 0.45
171 0.48
172 0.55
173 0.57
174 0.6
175 0.64
176 0.71
177 0.72
178 0.64
179 0.63
180 0.59
181 0.57
182 0.5
183 0.45
184 0.36
185 0.32
186 0.33
187 0.33
188 0.32
189 0.26
190 0.24
191 0.23
192 0.31
193 0.4
194 0.42
195 0.42
196 0.4
197 0.43
198 0.45
199 0.53
200 0.54
201 0.55
202 0.62
203 0.71
204 0.77
205 0.78
206 0.79
207 0.76
208 0.71
209 0.66
210 0.62
211 0.57
212 0.5
213 0.44
214 0.4
215 0.32
216 0.26
217 0.2
218 0.14
219 0.08
220 0.06
221 0.05
222 0.05
223 0.05
224 0.05
225 0.05
226 0.05
227 0.05
228 0.05
229 0.05
230 0.06
231 0.07
232 0.07
233 0.07
234 0.07
235 0.06
236 0.08
237 0.08
238 0.1
239 0.11
240 0.14
241 0.18
242 0.22
243 0.31
244 0.39
245 0.46
246 0.52
247 0.58
248 0.66
249 0.72
250 0.77
251 0.76
252 0.77
253 0.72
254 0.71
255 0.65
256 0.54
257 0.46
258 0.37
259 0.29
260 0.2
261 0.17
262 0.1
263 0.08
264 0.07
265 0.06
266 0.06
267 0.08
268 0.07
269 0.07
270 0.07
271 0.09
272 0.1
273 0.1
274 0.11
275 0.12
276 0.15
277 0.22
278 0.29
279 0.3
280 0.36
281 0.43
282 0.48
283 0.47
284 0.51
285 0.49
286 0.45
287 0.48
288 0.47
289 0.45
290 0.46
291 0.52
292 0.54
293 0.6
294 0.68
295 0.72
296 0.77