Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N5M8G6

Protein Details
Accession A0A5N5M8G6    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
59-81EINKAYRKKTRSLHPDKVKQNLAHydrophilic
NLS Segment(s)
PositionSequence
67-67K
77-77K
81-102AAERAAAAKAEAKKSKTGVKVA
250-288RKMRRLQEKDARKEADKERVSQGGRRGRKGAAAATSKPG
435-448QKQGKAGKRKNKKR
Subcellular Location(s) extr 9, plas 5, E.R. 5, mito 2, cyto 2, golg 2, cyto_mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001623  DnaJ_domain  
IPR036869  J_dom_sf  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF00226  DnaJ  
PROSITE View protein in PROSITE  
PS50076  DNAJ_2  
CDD cd06257  DnaJ  
Amino Acid Sequences MRIATLILGLLAILTPLSAAWSKEDREIFRLRDELAAHESPEITFYDFLGIKPSASQDEINKAYRKKTRSLHPDKVKQNLAAERAAAAKAEAKKSKTGVKVAKQPSSSEIKAAVKRASERQTRLSLVTNVLRGPGRERYDYFLANGFPKWKGTEYYYSRYRPGFGTVVVGVFLFAGGAAHYIALYMGWKRQREFVERYIKYARNAAWGENLGVNIPGVDAQPVAVQPPAPAPREQQMYEDENGRAMPMNRKMRRLQEKDARKEADKERVSQGGRRGRKGAAAATSKPGSGAATPRPQEAGTGPTGSKKRVVAENGKVLVVDSLGDVYLEQEDEDGNTQEFLLDPNEIARPTISDTAVVRLPLWFYQLTVGRVLNKRNKDDSSDDEFDNEDPAEDEEDSEPGKRTPSTDSADDFEMLDKSTESLGKDTAKASGASQKQGKAGKRKNKKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.03
4 0.06
5 0.08
6 0.08
7 0.14
8 0.18
9 0.2
10 0.27
11 0.33
12 0.33
13 0.38
14 0.44
15 0.42
16 0.42
17 0.43
18 0.37
19 0.36
20 0.34
21 0.32
22 0.32
23 0.3
24 0.27
25 0.25
26 0.24
27 0.2
28 0.2
29 0.17
30 0.13
31 0.12
32 0.11
33 0.15
34 0.15
35 0.15
36 0.19
37 0.18
38 0.17
39 0.18
40 0.2
41 0.17
42 0.19
43 0.22
44 0.2
45 0.28
46 0.32
47 0.37
48 0.41
49 0.41
50 0.48
51 0.52
52 0.53
53 0.54
54 0.58
55 0.62
56 0.67
57 0.74
58 0.77
59 0.8
60 0.85
61 0.83
62 0.83
63 0.78
64 0.69
65 0.66
66 0.6
67 0.53
68 0.44
69 0.38
70 0.31
71 0.28
72 0.24
73 0.18
74 0.13
75 0.15
76 0.19
77 0.26
78 0.3
79 0.3
80 0.34
81 0.37
82 0.44
83 0.44
84 0.48
85 0.5
86 0.52
87 0.6
88 0.63
89 0.66
90 0.6
91 0.56
92 0.52
93 0.51
94 0.44
95 0.35
96 0.34
97 0.34
98 0.36
99 0.38
100 0.36
101 0.31
102 0.34
103 0.4
104 0.43
105 0.44
106 0.45
107 0.47
108 0.49
109 0.48
110 0.47
111 0.44
112 0.37
113 0.34
114 0.33
115 0.28
116 0.24
117 0.24
118 0.22
119 0.19
120 0.2
121 0.24
122 0.25
123 0.26
124 0.28
125 0.31
126 0.34
127 0.34
128 0.31
129 0.26
130 0.24
131 0.22
132 0.22
133 0.19
134 0.16
135 0.17
136 0.17
137 0.16
138 0.17
139 0.2
140 0.28
141 0.31
142 0.38
143 0.43
144 0.44
145 0.45
146 0.44
147 0.41
148 0.33
149 0.31
150 0.26
151 0.19
152 0.19
153 0.16
154 0.15
155 0.14
156 0.12
157 0.08
158 0.07
159 0.06
160 0.03
161 0.03
162 0.02
163 0.02
164 0.03
165 0.03
166 0.03
167 0.03
168 0.03
169 0.03
170 0.03
171 0.04
172 0.04
173 0.09
174 0.13
175 0.15
176 0.16
177 0.22
178 0.26
179 0.32
180 0.36
181 0.41
182 0.47
183 0.46
184 0.49
185 0.5
186 0.49
187 0.43
188 0.42
189 0.34
190 0.3
191 0.31
192 0.27
193 0.22
194 0.21
195 0.21
196 0.17
197 0.16
198 0.09
199 0.09
200 0.08
201 0.05
202 0.05
203 0.04
204 0.04
205 0.04
206 0.03
207 0.04
208 0.04
209 0.04
210 0.05
211 0.05
212 0.05
213 0.05
214 0.09
215 0.12
216 0.13
217 0.14
218 0.15
219 0.19
220 0.23
221 0.23
222 0.21
223 0.22
224 0.23
225 0.24
226 0.24
227 0.2
228 0.17
229 0.16
230 0.15
231 0.12
232 0.11
233 0.16
234 0.21
235 0.32
236 0.34
237 0.39
238 0.43
239 0.51
240 0.6
241 0.6
242 0.61
243 0.6
244 0.68
245 0.7
246 0.73
247 0.67
248 0.58
249 0.59
250 0.54
251 0.55
252 0.47
253 0.43
254 0.39
255 0.42
256 0.41
257 0.38
258 0.42
259 0.41
260 0.43
261 0.43
262 0.43
263 0.37
264 0.39
265 0.37
266 0.32
267 0.29
268 0.29
269 0.27
270 0.29
271 0.29
272 0.26
273 0.24
274 0.21
275 0.15
276 0.12
277 0.15
278 0.17
279 0.23
280 0.24
281 0.24
282 0.26
283 0.25
284 0.24
285 0.22
286 0.19
287 0.14
288 0.16
289 0.15
290 0.2
291 0.22
292 0.22
293 0.24
294 0.22
295 0.24
296 0.28
297 0.34
298 0.36
299 0.4
300 0.46
301 0.44
302 0.42
303 0.38
304 0.32
305 0.26
306 0.18
307 0.12
308 0.05
309 0.05
310 0.04
311 0.04
312 0.04
313 0.05
314 0.05
315 0.05
316 0.05
317 0.04
318 0.05
319 0.06
320 0.07
321 0.08
322 0.08
323 0.08
324 0.08
325 0.07
326 0.08
327 0.08
328 0.08
329 0.07
330 0.07
331 0.08
332 0.1
333 0.1
334 0.11
335 0.1
336 0.1
337 0.13
338 0.16
339 0.15
340 0.16
341 0.16
342 0.19
343 0.2
344 0.19
345 0.16
346 0.13
347 0.15
348 0.13
349 0.15
350 0.12
351 0.11
352 0.16
353 0.2
354 0.21
355 0.22
356 0.23
357 0.27
358 0.31
359 0.39
360 0.43
361 0.46
362 0.51
363 0.55
364 0.56
365 0.54
366 0.56
367 0.55
368 0.55
369 0.52
370 0.46
371 0.4
372 0.39
373 0.33
374 0.3
375 0.22
376 0.13
377 0.1
378 0.11
379 0.12
380 0.11
381 0.13
382 0.11
383 0.13
384 0.13
385 0.14
386 0.15
387 0.14
388 0.17
389 0.16
390 0.17
391 0.22
392 0.28
393 0.32
394 0.35
395 0.37
396 0.37
397 0.38
398 0.36
399 0.31
400 0.25
401 0.21
402 0.17
403 0.15
404 0.12
405 0.11
406 0.13
407 0.15
408 0.15
409 0.16
410 0.19
411 0.21
412 0.23
413 0.23
414 0.24
415 0.23
416 0.22
417 0.23
418 0.28
419 0.29
420 0.35
421 0.39
422 0.4
423 0.44
424 0.51
425 0.56
426 0.59
427 0.65
428 0.68