FuNGI

A0A5N5P0E4

Protein Details

Accession

A0A5N5P0E4

Localization Confidence

Low

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
488-512	EEGVGRRGEWRRRRWVRLVRRKVVG	Basic

NLS Segment(s)

Position	Sequence
493-509	RRGEWRRRRWVRLVRRK

Subcellular Location(s)

plas 23, E.R. 2

Family & Domain DBs

InterPro	View protein in InterPro IPR010482 Peroxin
Gene Ontology	GO:0005778 C:peroxisomal membrane GO:0007031 P:peroxisome organization
Pfam	View protein in Pfam PF06398 Pex24p

Amino Acid Sequences

MEDLATAILNAPEDSPGPDDVDDTTPGAGPAAGSTSPTSGGFKRAVLKRGIFKAASMQDKLLEKLLAQVIPTDTATPSNLLSTSPPSDPLSAYAARPGFTIATMSANFRRFNARIGVVFHFQARVVRLLSWRQPTHTLSLLAVYTFLCLDPYLLFVLPLLLIIICVLIPSFIARHPAPAANPSEEFLRDMDYRPRGPPLAPAVTVKPVKELSRDFFKNLGHLQNSMEDFSVAHDKIVGFAEPKTNFSDEALSSAIFVLLCGLAVVMSLTAHLLPWRYLALVTGWAAICSNHPLASRLLSSPTTTPSANTPQPSSLLGPKDIVTTTTSRLSTLWSSFVSTDIILDQSPETREVEIFELQRLSLSGTGEWEAWVFSPSPYDPLSAARISGQRPPGTRFFEDVKPPPGWEWSEKKWMLDLWSREWVEERIITGVEVETEGERWVYDIWDKREGRTGVVEGGGGGETQVGGGDGNGRKGGRMGMGVSWEEGEEGVGRRGEWRRRRWVRLVRRKVVG

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.12
2	0.13
3	0.14
4	0.15
5	0.15
6	0.15
7	0.17
8	0.19
9	0.18
10	0.17
11	0.16
12	0.14
13	0.14
14	0.14
15	0.11
16	0.08
17	0.07
18	0.09
19	0.09
20	0.1
21	0.11
22	0.12
23	0.13
24	0.14
25	0.17
26	0.16
27	0.2
28	0.2
29	0.22
30	0.3
31	0.35
32	0.39
33	0.42
34	0.46
35	0.5
36	0.54
37	0.57
38	0.48
39	0.43
40	0.46
41	0.47
42	0.47
43	0.4
44	0.35
45	0.34
46	0.36
47	0.37
48	0.31
49	0.24
50	0.19
51	0.22
52	0.25
53	0.21
54	0.18
55	0.2
56	0.18
57	0.19
58	0.2
59	0.16
60	0.13
61	0.14
62	0.14
63	0.13
64	0.12
65	0.12
66	0.12
67	0.11
68	0.13
69	0.16
70	0.18
71	0.18
72	0.2
73	0.21
74	0.22
75	0.22
76	0.22
77	0.23
78	0.21
79	0.2
80	0.23
81	0.22
82	0.21
83	0.2
84	0.19
85	0.15
86	0.13
87	0.14
88	0.09
89	0.12
90	0.12
91	0.16
92	0.2
93	0.23
94	0.24
95	0.24
96	0.3
97	0.27
98	0.3
99	0.32
100	0.29
101	0.28
102	0.32
103	0.34
104	0.29
105	0.29
106	0.26
107	0.21
108	0.19
109	0.19
110	0.17
111	0.16
112	0.15
113	0.16
114	0.19
115	0.24
116	0.3
117	0.35
118	0.35
119	0.35
120	0.39
121	0.4
122	0.4
123	0.38
124	0.32
125	0.24
126	0.25
127	0.22
128	0.17
129	0.15
130	0.11
131	0.08
132	0.07
133	0.07
134	0.05
135	0.05
136	0.06
137	0.05
138	0.07
139	0.07
140	0.07
141	0.07
142	0.07
143	0.07
144	0.06
145	0.06
146	0.05
147	0.03
148	0.03
149	0.03
150	0.03
151	0.03
152	0.03
153	0.03
154	0.02
155	0.03
156	0.03
157	0.04
158	0.05
159	0.1
160	0.1
161	0.12
162	0.14
163	0.16
164	0.16
165	0.2
166	0.22
167	0.2
168	0.2
169	0.19
170	0.19
171	0.17
172	0.17
173	0.13
174	0.15
175	0.13
176	0.15
177	0.21
178	0.23
179	0.25
180	0.25
181	0.27
182	0.25
183	0.24
184	0.26
185	0.26
186	0.25
187	0.24
188	0.24
189	0.23
190	0.27
191	0.28
192	0.24
193	0.21
194	0.2
195	0.2
196	0.23
197	0.24
198	0.22
199	0.29
200	0.31
201	0.3
202	0.3
203	0.3
204	0.29
205	0.29
206	0.3
207	0.22
208	0.22
209	0.21
210	0.21
211	0.21
212	0.19
213	0.16
214	0.11
215	0.1
216	0.11
217	0.14
218	0.11
219	0.1
220	0.1
221	0.1
222	0.11
223	0.12
224	0.11
225	0.07
226	0.08
227	0.14
228	0.13
229	0.15
230	0.16
231	0.16
232	0.16
233	0.15
234	0.17
235	0.11
236	0.12
237	0.11
238	0.09
239	0.09
240	0.08
241	0.08
242	0.05
243	0.05
244	0.04
245	0.03
246	0.03
247	0.03
248	0.03
249	0.02
250	0.02
251	0.02
252	0.02
253	0.02
254	0.02
255	0.02
256	0.02
257	0.03
258	0.03
259	0.04
260	0.04
261	0.05
262	0.05
263	0.06
264	0.06
265	0.06
266	0.06
267	0.07
268	0.07
269	0.08
270	0.07
271	0.07
272	0.07
273	0.07
274	0.07
275	0.09
276	0.09
277	0.09
278	0.09
279	0.11
280	0.12
281	0.13
282	0.14
283	0.12
284	0.14
285	0.13
286	0.14
287	0.13
288	0.15
289	0.15
290	0.14
291	0.14
292	0.15
293	0.21
294	0.23
295	0.23
296	0.23
297	0.21
298	0.22
299	0.23
300	0.21
301	0.2
302	0.19
303	0.18
304	0.18
305	0.17
306	0.17
307	0.16
308	0.15
309	0.13
310	0.12
311	0.14
312	0.17
313	0.17
314	0.16
315	0.16
316	0.17
317	0.18
318	0.17
319	0.17
320	0.13
321	0.15
322	0.14
323	0.15
324	0.13
325	0.1
326	0.1
327	0.08
328	0.08
329	0.07
330	0.07
331	0.07
332	0.08
333	0.09
334	0.1
335	0.11
336	0.11
337	0.11
338	0.12
339	0.14
340	0.16
341	0.15
342	0.15
343	0.15
344	0.14
345	0.14
346	0.13
347	0.11
348	0.1
349	0.1
350	0.09
351	0.1
352	0.11
353	0.11
354	0.11
355	0.09
356	0.08
357	0.07
358	0.08
359	0.08
360	0.07
361	0.09
362	0.09
363	0.12
364	0.12
365	0.13
366	0.13
367	0.14
368	0.18
369	0.16
370	0.16
371	0.17
372	0.2
373	0.2
374	0.25
375	0.29
376	0.29
377	0.32
378	0.36
379	0.4
380	0.42
381	0.42
382	0.4
383	0.39
384	0.41
385	0.46
386	0.46
387	0.44
388	0.39
389	0.38
390	0.35
391	0.35
392	0.33
393	0.32
394	0.35
395	0.35
396	0.44
397	0.44
398	0.43
399	0.41
400	0.39
401	0.38
402	0.38
403	0.37
404	0.32
405	0.4
406	0.39
407	0.37
408	0.38
409	0.34
410	0.29
411	0.26
412	0.22
413	0.15
414	0.15
415	0.15
416	0.13
417	0.12
418	0.09
419	0.08
420	0.08
421	0.07
422	0.08
423	0.08
424	0.07
425	0.07
426	0.08
427	0.08
428	0.09
429	0.15
430	0.21
431	0.26
432	0.35
433	0.36
434	0.37
435	0.46
436	0.45
437	0.41
438	0.38
439	0.35
440	0.27
441	0.27
442	0.25
443	0.16
444	0.16
445	0.14
446	0.09
447	0.07
448	0.05
449	0.04
450	0.04
451	0.04
452	0.04
453	0.03
454	0.04
455	0.11
456	0.12
457	0.15
458	0.18
459	0.18
460	0.18
461	0.19
462	0.21
463	0.17
464	0.17
465	0.17
466	0.16
467	0.19
468	0.2
469	0.19
470	0.17
471	0.15
472	0.13
473	0.12
474	0.1
475	0.09
476	0.11
477	0.13
478	0.13
479	0.14
480	0.2
481	0.29
482	0.39
483	0.46
484	0.54
485	0.62
486	0.71
487	0.8
488	0.84
489	0.87
490	0.88
491	0.89
492	0.91

A0A5N5P0E4

3D AlphaFold-predicted Structure Viewer