Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C5DIS7

Protein Details
Accession C5DIS7    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MSAPREAKKRTTRRKKDPNAPKRALSHydrophilic
NLS Segment(s)
PositionSequence
5-23REAKKRTTRRKKDPNAPKR
Subcellular Location(s) nucl 18.5, cyto_nucl 12, cyto 4.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
KEGG lth:KLTH0E14850g  -  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MSAPREAKKRTTRRKKDPNAPKRALSAYMFFANENRDIVRAENPGVTFGQVGRLLGDKWKALTDEEKQPYEAKHAADKKRYESEKELYNATKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.93
2 0.94
3 0.94
4 0.94
5 0.94
6 0.93
7 0.87
8 0.78
9 0.71
10 0.63
11 0.56
12 0.47
13 0.38
14 0.31
15 0.28
16 0.25
17 0.21
18 0.2
19 0.18
20 0.17
21 0.15
22 0.12
23 0.11
24 0.11
25 0.12
26 0.13
27 0.13
28 0.13
29 0.13
30 0.13
31 0.13
32 0.13
33 0.12
34 0.09
35 0.08
36 0.1
37 0.08
38 0.08
39 0.08
40 0.08
41 0.08
42 0.11
43 0.12
44 0.1
45 0.1
46 0.11
47 0.12
48 0.12
49 0.17
50 0.19
51 0.27
52 0.31
53 0.31
54 0.32
55 0.33
56 0.32
57 0.34
58 0.32
59 0.25
60 0.3
61 0.37
62 0.44
63 0.5
64 0.53
65 0.54
66 0.6
67 0.63
68 0.6
69 0.58
70 0.56
71 0.56
72 0.54
73 0.54