Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N5LCB9

Protein Details
Accession A0A5N5LCB9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
161-180QIGREKLLSHKEKPRKEKELBasic
NLS Segment(s)
PositionSequence
170-178HKEKPRKEK
Subcellular Location(s) mito 12, cyto 6.5, cyto_nucl 4.5, plas 3, E.R. 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR019560  Mitochondrial_18_kDa_protein  
Pfam View protein in Pfam  
PF10558  MTP18  
Amino Acid Sequences MVRAAYGISWAYILGDVGYEGYKAYWHNQRVLNPSVNLPDESKRLTGLSEMPAVGAVVAPGTVPPLEDYRVVMLQRGIFQSLASMGLPAFTIHSVVRYSGRALKNAKNTTIRTYGPIGLGLAVVPFLPALFDKPVENAVEFVFHKGFETFGGHKAVGEAPQIGREKLLSHKEKPRKEKEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.05
4 0.06
5 0.06
6 0.05
7 0.05
8 0.05
9 0.07
10 0.08
11 0.14
12 0.22
13 0.25
14 0.31
15 0.36
16 0.41
17 0.46
18 0.5
19 0.49
20 0.42
21 0.41
22 0.38
23 0.35
24 0.31
25 0.28
26 0.25
27 0.23
28 0.24
29 0.23
30 0.2
31 0.18
32 0.17
33 0.16
34 0.16
35 0.16
36 0.15
37 0.14
38 0.13
39 0.13
40 0.12
41 0.1
42 0.07
43 0.04
44 0.03
45 0.03
46 0.03
47 0.02
48 0.03
49 0.03
50 0.04
51 0.05
52 0.07
53 0.08
54 0.08
55 0.09
56 0.1
57 0.13
58 0.12
59 0.12
60 0.12
61 0.11
62 0.13
63 0.13
64 0.12
65 0.1
66 0.1
67 0.09
68 0.08
69 0.08
70 0.06
71 0.05
72 0.04
73 0.04
74 0.05
75 0.04
76 0.04
77 0.04
78 0.05
79 0.05
80 0.06
81 0.06
82 0.07
83 0.08
84 0.08
85 0.1
86 0.16
87 0.18
88 0.21
89 0.25
90 0.3
91 0.38
92 0.39
93 0.42
94 0.41
95 0.41
96 0.41
97 0.41
98 0.36
99 0.3
100 0.31
101 0.28
102 0.22
103 0.21
104 0.16
105 0.12
106 0.12
107 0.09
108 0.06
109 0.04
110 0.04
111 0.03
112 0.03
113 0.03
114 0.03
115 0.03
116 0.06
117 0.07
118 0.08
119 0.09
120 0.1
121 0.12
122 0.13
123 0.13
124 0.12
125 0.11
126 0.14
127 0.14
128 0.16
129 0.14
130 0.13
131 0.14
132 0.13
133 0.13
134 0.11
135 0.15
136 0.15
137 0.17
138 0.2
139 0.19
140 0.19
141 0.2
142 0.2
143 0.17
144 0.17
145 0.16
146 0.14
147 0.2
148 0.22
149 0.21
150 0.2
151 0.19
152 0.2
153 0.26
154 0.35
155 0.36
156 0.42
157 0.52
158 0.61
159 0.71
160 0.79