Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N5MYF9

Protein Details
Accession A0A5N5MYF9    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
16-37DIANLKKRAKRLRADIKTHCSTHydrophilic
203-228GLVDADEKRRNRRKRRRTEGESEAADBasic
NLS Segment(s)
PositionSequence
210-219KRRNRRKRRR
Subcellular Location(s) nucl 12, cyto_nucl 11, cyto 8, pero 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018464  CENP-O  
Gene Ontology GO:0000776  C:kinetochore  
GO:0005634  C:nucleus  
GO:0034508  P:centromere complex assembly  
Pfam View protein in Pfam  
PF09496  CENP-O  
Amino Acid Sequences MATEGLDSEEAMFDDDIANLKKRAKRLRADIKTHCSTIASAFAPEDFPAELVDIISQQQAHTQESLWRIGAGVTAFKVQDPDPRAVNGGSVLGIRFEIMRNGRFIQIYVVLLNRPYGKDGQEDHVTKAYLRVHRHTIPNCIPLGGLAARYLPPPTVTDAIGDDDGPAKRKTQNLSLFVKELRQRLVAYHNRLGAVADMRRAAGLVDADEKRRNRRKRRRTEGESEAADDSTGSDEEDESDDGDDDGGAPRIIEFSSKDAEAKQIEVNWSNGDLCRIVLDDDGEIEKCVMFGANGQRDAAAAREFQQRVTRVDRLQDAIRRKRGLEPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.09
3 0.12
4 0.14
5 0.17
6 0.18
7 0.25
8 0.3
9 0.38
10 0.48
11 0.53
12 0.6
13 0.68
14 0.77
15 0.8
16 0.85
17 0.85
18 0.84
19 0.79
20 0.71
21 0.61
22 0.5
23 0.42
24 0.34
25 0.3
26 0.22
27 0.18
28 0.17
29 0.17
30 0.16
31 0.15
32 0.15
33 0.1
34 0.09
35 0.09
36 0.09
37 0.08
38 0.08
39 0.08
40 0.07
41 0.08
42 0.09
43 0.08
44 0.08
45 0.12
46 0.14
47 0.15
48 0.15
49 0.15
50 0.19
51 0.21
52 0.23
53 0.19
54 0.17
55 0.16
56 0.15
57 0.16
58 0.12
59 0.1
60 0.09
61 0.11
62 0.11
63 0.11
64 0.12
65 0.11
66 0.17
67 0.2
68 0.22
69 0.21
70 0.22
71 0.24
72 0.22
73 0.21
74 0.15
75 0.12
76 0.1
77 0.09
78 0.08
79 0.06
80 0.06
81 0.06
82 0.06
83 0.06
84 0.11
85 0.13
86 0.14
87 0.17
88 0.19
89 0.2
90 0.2
91 0.2
92 0.17
93 0.16
94 0.15
95 0.13
96 0.12
97 0.11
98 0.11
99 0.12
100 0.12
101 0.1
102 0.12
103 0.13
104 0.13
105 0.17
106 0.19
107 0.22
108 0.27
109 0.28
110 0.28
111 0.29
112 0.28
113 0.24
114 0.26
115 0.27
116 0.26
117 0.28
118 0.29
119 0.33
120 0.37
121 0.44
122 0.42
123 0.44
124 0.42
125 0.43
126 0.39
127 0.33
128 0.29
129 0.21
130 0.21
131 0.13
132 0.1
133 0.06
134 0.07
135 0.07
136 0.08
137 0.08
138 0.06
139 0.07
140 0.07
141 0.1
142 0.1
143 0.1
144 0.1
145 0.11
146 0.12
147 0.11
148 0.1
149 0.07
150 0.09
151 0.09
152 0.11
153 0.11
154 0.11
155 0.14
156 0.18
157 0.2
158 0.26
159 0.33
160 0.36
161 0.39
162 0.39
163 0.38
164 0.35
165 0.37
166 0.32
167 0.27
168 0.23
169 0.21
170 0.2
171 0.2
172 0.29
173 0.3
174 0.33
175 0.34
176 0.33
177 0.32
178 0.32
179 0.3
180 0.22
181 0.19
182 0.14
183 0.12
184 0.11
185 0.11
186 0.1
187 0.1
188 0.09
189 0.07
190 0.06
191 0.06
192 0.1
193 0.12
194 0.14
195 0.2
196 0.22
197 0.31
198 0.41
199 0.51
200 0.57
201 0.67
202 0.76
203 0.82
204 0.91
205 0.92
206 0.91
207 0.89
208 0.86
209 0.81
210 0.71
211 0.62
212 0.51
213 0.4
214 0.32
215 0.23
216 0.15
217 0.1
218 0.08
219 0.06
220 0.05
221 0.06
222 0.07
223 0.08
224 0.08
225 0.07
226 0.08
227 0.08
228 0.08
229 0.08
230 0.06
231 0.05
232 0.06
233 0.07
234 0.06
235 0.06
236 0.06
237 0.07
238 0.07
239 0.08
240 0.08
241 0.1
242 0.13
243 0.14
244 0.15
245 0.14
246 0.19
247 0.18
248 0.19
249 0.18
250 0.18
251 0.22
252 0.23
253 0.24
254 0.2
255 0.21
256 0.2
257 0.18
258 0.17
259 0.14
260 0.12
261 0.11
262 0.11
263 0.11
264 0.1
265 0.11
266 0.09
267 0.1
268 0.12
269 0.11
270 0.11
271 0.1
272 0.09
273 0.08
274 0.08
275 0.07
276 0.06
277 0.1
278 0.19
279 0.24
280 0.25
281 0.26
282 0.25
283 0.25
284 0.26
285 0.24
286 0.16
287 0.12
288 0.15
289 0.24
290 0.24
291 0.28
292 0.34
293 0.35
294 0.39
295 0.44
296 0.47
297 0.42
298 0.48
299 0.49
300 0.46
301 0.5
302 0.52
303 0.56
304 0.59
305 0.64
306 0.61
307 0.59