Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N5KJ67

Protein Details
Accession A0A5N5KJ67    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
215-239LVKDKIGKETEKKRRRNFRDDDGMFBasic
NLS Segment(s)
PositionSequence
226-229KKRR
Subcellular Location(s) nucl 12, cyto_nucl 10.333, mito_nucl 9.833, cyto 7.5, mito 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013830  SGNH_hydro  
IPR036514  SGNH_hydro_sf  
Gene Ontology GO:0016787  F:hydrolase activity  
Pfam View protein in Pfam  
PF13472  Lipase_GDSL_2  
CDD cd00229  SGNH_hydrolase  
Amino Acid Sequences MAPREPPTKKIRILCFGDSLTAGYSRMGSVYHPYSEKLVQMVEMAFPEYEVESVEDGVPGDLVSGRGTFLSRMERQFAKDDPNKAPYDWTIILGGTNDIAWGTDPETIFSSLLATYSIPLSASPPSKVLALTIPEAGIPPGPTRDRVEAKRNQVNSLIKSHRSPNYHVFDLEAAVPYWKMEEVDRKKYWDDHIHFTSQGYDLIGKKVGMALVSLLVKDKIGKETEKKRRRNFRDDDGMFEEEGGDPNSLDQGYIVVRRKDLE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.61
3 0.53
4 0.47
5 0.39
6 0.32
7 0.24
8 0.19
9 0.16
10 0.11
11 0.11
12 0.1
13 0.1
14 0.09
15 0.09
16 0.14
17 0.17
18 0.2
19 0.21
20 0.22
21 0.25
22 0.26
23 0.26
24 0.21
25 0.18
26 0.15
27 0.15
28 0.15
29 0.12
30 0.11
31 0.11
32 0.09
33 0.09
34 0.09
35 0.08
36 0.07
37 0.07
38 0.08
39 0.07
40 0.08
41 0.08
42 0.08
43 0.08
44 0.08
45 0.07
46 0.05
47 0.05
48 0.05
49 0.05
50 0.06
51 0.06
52 0.06
53 0.06
54 0.07
55 0.07
56 0.09
57 0.15
58 0.19
59 0.21
60 0.25
61 0.26
62 0.28
63 0.31
64 0.31
65 0.33
66 0.35
67 0.39
68 0.38
69 0.42
70 0.41
71 0.38
72 0.38
73 0.29
74 0.3
75 0.25
76 0.22
77 0.17
78 0.15
79 0.15
80 0.13
81 0.13
82 0.06
83 0.06
84 0.04
85 0.04
86 0.04
87 0.04
88 0.04
89 0.05
90 0.07
91 0.07
92 0.09
93 0.1
94 0.11
95 0.1
96 0.1
97 0.1
98 0.07
99 0.07
100 0.07
101 0.05
102 0.05
103 0.05
104 0.05
105 0.04
106 0.04
107 0.06
108 0.08
109 0.09
110 0.1
111 0.1
112 0.11
113 0.11
114 0.11
115 0.11
116 0.09
117 0.1
118 0.1
119 0.09
120 0.09
121 0.08
122 0.08
123 0.08
124 0.07
125 0.06
126 0.05
127 0.08
128 0.09
129 0.11
130 0.14
131 0.19
132 0.24
133 0.28
134 0.36
135 0.39
136 0.46
137 0.51
138 0.49
139 0.46
140 0.46
141 0.46
142 0.4
143 0.41
144 0.37
145 0.33
146 0.34
147 0.38
148 0.38
149 0.37
150 0.39
151 0.4
152 0.43
153 0.42
154 0.39
155 0.35
156 0.29
157 0.27
158 0.23
159 0.15
160 0.09
161 0.08
162 0.08
163 0.07
164 0.07
165 0.06
166 0.06
167 0.08
168 0.18
169 0.24
170 0.34
171 0.36
172 0.38
173 0.4
174 0.42
175 0.47
176 0.47
177 0.45
178 0.44
179 0.45
180 0.45
181 0.43
182 0.4
183 0.35
184 0.26
185 0.22
186 0.15
187 0.15
188 0.13
189 0.15
190 0.16
191 0.14
192 0.13
193 0.13
194 0.13
195 0.1
196 0.09
197 0.08
198 0.09
199 0.1
200 0.1
201 0.1
202 0.09
203 0.1
204 0.12
205 0.13
206 0.15
207 0.18
208 0.24
209 0.32
210 0.43
211 0.54
212 0.61
213 0.7
214 0.76
215 0.84
216 0.87
217 0.89
218 0.86
219 0.85
220 0.86
221 0.78
222 0.74
223 0.68
224 0.61
225 0.5
226 0.42
227 0.33
228 0.22
229 0.22
230 0.17
231 0.11
232 0.09
233 0.1
234 0.12
235 0.11
236 0.1
237 0.08
238 0.08
239 0.11
240 0.18
241 0.25
242 0.25