Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5DLM1

Protein Details
Accession C5DLM1    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-32MAETKKHELKDQPDKKRVKRRRNYDDYDKEVABasic
NLS Segment(s)
PositionSequence
14-22DKKRVKRRR
Subcellular Location(s) nucl 26.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR019098  Histone_chaperone_domain_CHZ  
Gene Ontology GO:0005634  C:nucleus  
KEGG lth:KLTH0G01782g  -  
Pfam View protein in Pfam  
PF09649  CHZ  
Amino Acid Sequences MAETKKHELKDQPDKKRVKRRRNYDDYDKEVAAEDSKAKKENKGTGDNGSESESEDDEKLDMMLNKEDEEEDDLAEIDSSNIIQGGRRTRGKVIDYKKTAEALDKESGKASEEPKEELAQKDVAKKSETAEEDEDAEDADFKEPEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.84
3 0.87
4 0.88
5 0.88
6 0.89
7 0.89
8 0.91
9 0.92
10 0.9
11 0.9
12 0.89
13 0.85
14 0.79
15 0.67
16 0.56
17 0.47
18 0.39
19 0.29
20 0.21
21 0.19
22 0.18
23 0.21
24 0.26
25 0.26
26 0.3
27 0.35
28 0.41
29 0.43
30 0.45
31 0.45
32 0.44
33 0.46
34 0.42
35 0.36
36 0.31
37 0.25
38 0.19
39 0.17
40 0.13
41 0.11
42 0.1
43 0.1
44 0.08
45 0.08
46 0.07
47 0.07
48 0.08
49 0.08
50 0.09
51 0.09
52 0.1
53 0.1
54 0.1
55 0.09
56 0.1
57 0.09
58 0.07
59 0.07
60 0.07
61 0.06
62 0.06
63 0.06
64 0.03
65 0.03
66 0.03
67 0.03
68 0.03
69 0.03
70 0.04
71 0.07
72 0.12
73 0.18
74 0.2
75 0.22
76 0.24
77 0.29
78 0.32
79 0.37
80 0.39
81 0.44
82 0.45
83 0.46
84 0.45
85 0.42
86 0.39
87 0.35
88 0.31
89 0.26
90 0.29
91 0.27
92 0.26
93 0.26
94 0.25
95 0.23
96 0.24
97 0.22
98 0.23
99 0.24
100 0.26
101 0.27
102 0.3
103 0.3
104 0.28
105 0.29
106 0.26
107 0.27
108 0.33
109 0.34
110 0.34
111 0.33
112 0.32
113 0.31
114 0.35
115 0.34
116 0.31
117 0.31
118 0.29
119 0.29
120 0.29
121 0.26
122 0.19
123 0.17
124 0.13
125 0.11
126 0.11