Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q758S2

Protein Details
Accession Q758S2    Localization Confidence High Confidence Score 18.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MVAKKRTQLRAKAMRQRRNSSEAHydrophilic
65-90NGGISKSALRRRKKRMKEELKPRMEDBasic
NLS Segment(s)
PositionSequence
70-85KSALRRRKKRMKEELK
Subcellular Location(s) nucl 21, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR028160  Slx9-like  
Gene Ontology GO:0030686  C:90S preribosome  
GO:0005730  C:nucleolus  
GO:0030688  C:preribosome, small subunit precursor  
GO:0032040  C:small-subunit processome  
GO:0051880  F:G-quadruplex DNA binding  
GO:0000462  P:maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0000056  P:ribosomal small subunit export from nucleus  
KEGG ago:AGOS_AEL319C  -  
Pfam View protein in Pfam  
PF15341  SLX9  
Amino Acid Sequences MVAKKRTQLRAKAMRQRRNSSEAMETEELPPDPKAFLHQLRESKREKQLNRSQSFLNRLRDQAGNGGISKSALRRRKKRMKEELKPRMEDLLTSLKEEGVLEEDESGELAAVTGVTAITASNGYSGLHDTAEACGTVRIRKNEPSIRTQRGAKLLTTKEQERFTKVISNERFRSSPFETLREIIKSRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.86
3 0.86
4 0.81
5 0.77
6 0.69
7 0.63
8 0.59
9 0.51
10 0.49
11 0.42
12 0.36
13 0.31
14 0.31
15 0.27
16 0.22
17 0.21
18 0.15
19 0.14
20 0.12
21 0.16
22 0.2
23 0.25
24 0.3
25 0.36
26 0.44
27 0.49
28 0.56
29 0.56
30 0.57
31 0.61
32 0.63
33 0.61
34 0.63
35 0.67
36 0.71
37 0.68
38 0.63
39 0.58
40 0.54
41 0.59
42 0.55
43 0.53
44 0.45
45 0.43
46 0.44
47 0.41
48 0.36
49 0.31
50 0.26
51 0.2
52 0.18
53 0.17
54 0.14
55 0.13
56 0.13
57 0.13
58 0.19
59 0.26
60 0.35
61 0.44
62 0.55
63 0.65
64 0.74
65 0.8
66 0.84
67 0.87
68 0.88
69 0.9
70 0.9
71 0.85
72 0.77
73 0.67
74 0.58
75 0.47
76 0.37
77 0.29
78 0.26
79 0.2
80 0.19
81 0.18
82 0.15
83 0.16
84 0.15
85 0.12
86 0.07
87 0.07
88 0.06
89 0.06
90 0.06
91 0.06
92 0.06
93 0.05
94 0.03
95 0.03
96 0.03
97 0.02
98 0.02
99 0.02
100 0.02
101 0.02
102 0.02
103 0.02
104 0.02
105 0.03
106 0.03
107 0.03
108 0.03
109 0.04
110 0.04
111 0.05
112 0.06
113 0.07
114 0.06
115 0.07
116 0.07
117 0.07
118 0.08
119 0.07
120 0.06
121 0.08
122 0.09
123 0.14
124 0.19
125 0.23
126 0.26
127 0.32
128 0.4
129 0.46
130 0.49
131 0.53
132 0.57
133 0.59
134 0.6
135 0.58
136 0.55
137 0.54
138 0.52
139 0.45
140 0.45
141 0.42
142 0.44
143 0.46
144 0.45
145 0.44
146 0.49
147 0.49
148 0.47
149 0.45
150 0.41
151 0.43
152 0.4
153 0.45
154 0.46
155 0.52
156 0.5
157 0.53
158 0.52
159 0.46
160 0.52
161 0.46
162 0.47
163 0.43
164 0.43
165 0.41
166 0.42
167 0.44
168 0.42