Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5DML1

Protein Details
Accession C5DML1    Localization Confidence High Confidence Score 17.8
NoLS Segment(s)
PositionSequenceProtein Nature
166-193REQLRELKIKRRRPGKKQRLAKKAGSERBasic
196-232ERLEKAKELKKLAKKKFHKRGGKKNKKTESDGPSKPRBasic
NLS Segment(s)
PositionSequence
169-232LRELKIKRRRPGKKQRLAKKAGSERVQERLEKAKELKKLAKKKFHKRGGKKNKKTESDGPSKPR
Subcellular Location(s) nucl 21, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR018555  DUF2011  
KEGG lth:KLTH0G09812g  -  
Pfam View protein in Pfam  
PF09428  DUF2011  
Amino Acid Sequences MNEYRRVTREELFDNDPDEPLQEEQPLIEPDLEFITVNDVQVSDSKQDNDPEGAQEFEFPLFSFGAMENSASHDSEKDDAEESRGRTSTRLMKVSLREPSPDFFKQERPRSFYFAEYSVEQTNNFKTAAIEANDILRESAAAPNLRWSQFRGRLWDLKSHNAKIEREQLRELKIKRRRPGKKQRLAKKAGSERVQERLEKAKELKKLAKKKFHKRGGKKNKKTESDGPSKPRFRTE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.36
3 0.32
4 0.26
5 0.22
6 0.19
7 0.16
8 0.16
9 0.14
10 0.14
11 0.13
12 0.17
13 0.17
14 0.16
15 0.15
16 0.13
17 0.14
18 0.15
19 0.15
20 0.11
21 0.09
22 0.13
23 0.13
24 0.13
25 0.12
26 0.11
27 0.11
28 0.13
29 0.15
30 0.12
31 0.15
32 0.17
33 0.19
34 0.21
35 0.23
36 0.23
37 0.22
38 0.22
39 0.21
40 0.2
41 0.17
42 0.16
43 0.14
44 0.12
45 0.11
46 0.09
47 0.09
48 0.08
49 0.08
50 0.08
51 0.07
52 0.09
53 0.08
54 0.09
55 0.07
56 0.11
57 0.12
58 0.11
59 0.11
60 0.1
61 0.12
62 0.13
63 0.13
64 0.11
65 0.12
66 0.11
67 0.15
68 0.18
69 0.18
70 0.19
71 0.19
72 0.18
73 0.18
74 0.22
75 0.27
76 0.28
77 0.29
78 0.28
79 0.31
80 0.34
81 0.38
82 0.39
83 0.32
84 0.29
85 0.28
86 0.28
87 0.3
88 0.28
89 0.28
90 0.25
91 0.33
92 0.39
93 0.47
94 0.5
95 0.5
96 0.5
97 0.5
98 0.5
99 0.43
100 0.36
101 0.28
102 0.25
103 0.2
104 0.2
105 0.17
106 0.16
107 0.14
108 0.13
109 0.12
110 0.12
111 0.11
112 0.09
113 0.08
114 0.09
115 0.12
116 0.12
117 0.12
118 0.11
119 0.12
120 0.12
121 0.12
122 0.1
123 0.06
124 0.05
125 0.06
126 0.07
127 0.09
128 0.09
129 0.09
130 0.15
131 0.18
132 0.19
133 0.19
134 0.21
135 0.27
136 0.34
137 0.36
138 0.38
139 0.39
140 0.44
141 0.46
142 0.5
143 0.45
144 0.46
145 0.5
146 0.45
147 0.46
148 0.45
149 0.45
150 0.41
151 0.48
152 0.44
153 0.42
154 0.45
155 0.43
156 0.43
157 0.49
158 0.48
159 0.48
160 0.52
161 0.58
162 0.61
163 0.69
164 0.73
165 0.77
166 0.85
167 0.86
168 0.87
169 0.89
170 0.91
171 0.9
172 0.87
173 0.83
174 0.82
175 0.8
176 0.78
177 0.73
178 0.69
179 0.62
180 0.62
181 0.59
182 0.5
183 0.45
184 0.46
185 0.42
186 0.42
187 0.45
188 0.44
189 0.47
190 0.53
191 0.58
192 0.59
193 0.68
194 0.72
195 0.76
196 0.8
197 0.85
198 0.89
199 0.9
200 0.91
201 0.91
202 0.93
203 0.94
204 0.95
205 0.94
206 0.94
207 0.94
208 0.9
209 0.88
210 0.86
211 0.84
212 0.82
213 0.81
214 0.79
215 0.79
216 0.78