Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5DGD4

Protein Details
Accession C5DGD4   
Localization Confidence Low
Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
15-41LLWKIPWRMSRPQKQRQRHRLQDVDSVHydrophilic
109-131YRKGIHKLPKWTKITQRRNPAFFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20.5, mito_nucl 13.333, nucl 5, cyto_nucl 3.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
KEGG lth:KLTH0D04400g  -  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGPFKSSNTLLGGLLWKIPWRMSRPQKQRQRHRLQDVDSVIKSLNLGLHAERSVQKGISYDEAINSSKQLKPGVKQLRLLNKPSLFPNEPQMSYKDKYTYFNKQAKGYRKGIHKLPKWTKITQRRNPAFF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.15
4 0.14
5 0.14
6 0.16
7 0.2
8 0.24
9 0.33
10 0.43
11 0.53
12 0.61
13 0.71
14 0.78
15 0.84
16 0.9
17 0.9
18 0.91
19 0.9
20 0.9
21 0.87
22 0.8
23 0.77
24 0.7
25 0.64
26 0.53
27 0.44
28 0.34
29 0.27
30 0.23
31 0.15
32 0.12
33 0.07
34 0.08
35 0.07
36 0.09
37 0.09
38 0.11
39 0.12
40 0.13
41 0.13
42 0.13
43 0.13
44 0.12
45 0.13
46 0.13
47 0.13
48 0.11
49 0.11
50 0.13
51 0.13
52 0.12
53 0.12
54 0.12
55 0.12
56 0.13
57 0.16
58 0.16
59 0.17
60 0.27
61 0.35
62 0.36
63 0.4
64 0.44
65 0.5
66 0.52
67 0.54
68 0.51
69 0.43
70 0.42
71 0.4
72 0.41
73 0.34
74 0.31
75 0.36
76 0.33
77 0.33
78 0.32
79 0.33
80 0.32
81 0.31
82 0.32
83 0.29
84 0.26
85 0.31
86 0.35
87 0.43
88 0.46
89 0.52
90 0.53
91 0.56
92 0.62
93 0.66
94 0.67
95 0.64
96 0.61
97 0.63
98 0.65
99 0.67
100 0.69
101 0.67
102 0.71
103 0.74
104 0.77
105 0.74
106 0.76
107 0.78
108 0.78
109 0.82
110 0.81
111 0.82