Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5DNP0

Protein Details
Accession C5DNP0   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
74-95KYLKYLTKKYLKKNQLRDWIRFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11, cyto_nucl 10.5, cyto 8, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR002671  Ribosomal_L22e  
IPR038526  Ribosomal_L22e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG lth:KLTH0G18678g  -  
Pfam View protein in Pfam  
PF01776  Ribosomal_L22e  
Amino Acid Sequences MAPVTSRKQKITKTFTVDVSSPTENGVFDPASYAKYLIDHIKVDGHLGNLGNAITVEQNDSVVTVVSTTKFSGKYLKYLTKKYLKKNQLRDWIRFISTKTNQYKLAFYQVTPEDEEDEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.63
3 0.6
4 0.53
5 0.45
6 0.41
7 0.34
8 0.26
9 0.23
10 0.2
11 0.16
12 0.15
13 0.15
14 0.1
15 0.09
16 0.11
17 0.11
18 0.11
19 0.11
20 0.11
21 0.09
22 0.09
23 0.12
24 0.12
25 0.14
26 0.13
27 0.14
28 0.15
29 0.15
30 0.16
31 0.14
32 0.12
33 0.11
34 0.1
35 0.1
36 0.08
37 0.08
38 0.07
39 0.06
40 0.06
41 0.04
42 0.04
43 0.05
44 0.04
45 0.05
46 0.04
47 0.05
48 0.04
49 0.04
50 0.04
51 0.04
52 0.04
53 0.05
54 0.06
55 0.06
56 0.08
57 0.09
58 0.1
59 0.16
60 0.17
61 0.22
62 0.26
63 0.35
64 0.38
65 0.42
66 0.49
67 0.52
68 0.58
69 0.62
70 0.67
71 0.68
72 0.72
73 0.79
74 0.8
75 0.81
76 0.8
77 0.76
78 0.72
79 0.66
80 0.6
81 0.51
82 0.44
83 0.43
84 0.43
85 0.48
86 0.47
87 0.47
88 0.49
89 0.49
90 0.51
91 0.44
92 0.47
93 0.39
94 0.34
95 0.37
96 0.35
97 0.35
98 0.34
99 0.32