Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q751I7

Protein Details
Accession Q751I7   
Localization Confidence Medium
Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
2-32AASLPHPKIVKKHTKKFKRHHSDRYHRVAENBasic
NLS Segment(s)
PositionSequence
9-26KIVKKHTKKFKRHHSDRY
Subcellular Location(s) mito 16.5, mito_nucl 12.5, nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG ago:AGOS_AGL281C  -  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MAASLPHPKIVKKHTKKFKRHHSDRYHRVAENWRKQKGIDSVVRRRFRGQISEPTIGYGSNKKTRFMTPSGHKTYLVSNIKDLEVLMMHTKTYAAEIASNVSSKNRVSILARAKALGIKVTNPKGRLALEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.8
3 0.88
4 0.91
5 0.92
6 0.92
7 0.92
8 0.92
9 0.92
10 0.93
11 0.92
12 0.9
13 0.85
14 0.74
15 0.69
16 0.69
17 0.68
18 0.68
19 0.67
20 0.6
21 0.55
22 0.54
23 0.56
24 0.52
25 0.49
26 0.46
27 0.46
28 0.53
29 0.62
30 0.66
31 0.6
32 0.56
33 0.54
34 0.49
35 0.48
36 0.43
37 0.43
38 0.45
39 0.46
40 0.43
41 0.39
42 0.36
43 0.28
44 0.25
45 0.19
46 0.18
47 0.23
48 0.24
49 0.24
50 0.26
51 0.28
52 0.31
53 0.3
54 0.32
55 0.32
56 0.41
57 0.45
58 0.44
59 0.42
60 0.39
61 0.38
62 0.4
63 0.37
64 0.28
65 0.24
66 0.24
67 0.24
68 0.23
69 0.21
70 0.12
71 0.08
72 0.08
73 0.09
74 0.08
75 0.08
76 0.08
77 0.08
78 0.08
79 0.08
80 0.08
81 0.06
82 0.07
83 0.08
84 0.1
85 0.11
86 0.11
87 0.11
88 0.11
89 0.13
90 0.12
91 0.14
92 0.13
93 0.15
94 0.17
95 0.25
96 0.32
97 0.36
98 0.36
99 0.34
100 0.34
101 0.34
102 0.32
103 0.29
104 0.22
105 0.21
106 0.3
107 0.38
108 0.42
109 0.41
110 0.43
111 0.42