Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C5DD88

Protein Details
Accession C5DD88    Localization Confidence Medium Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
26-45GSNKIKRKIRDIERLLQKKKBasic
NLS Segment(s)
PositionSequence
29-34KIKRKI
Subcellular Location(s) nucl 17, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR019310  Efg1  
Gene Ontology GO:0006364  P:rRNA processing  
KEGG lth:KLTH0B09218g  -  
Pfam View protein in Pfam  
PF10153  Efg1  
Amino Acid Sequences MDRKQRRRTNKSAGAPIQLARVLGSGSNKIKRKIRDIERLLQKKKDVLPDTVLIEKERALEALRLELHNAEQRVKIQNNAKKYHMVRFFERKKALRRYTKSVKEGDADAVRERSIDLCYVVNFPKTEKYIALYPSEESESRDTDDKKGVAKTEARRAQFRDLVAAKMDAGTLPVPLKDILKGKKLDRDDTGVQLETGESRASKEASISESEKEDEDEDDFFE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.68
3 0.59
4 0.51
5 0.41
6 0.33
7 0.23
8 0.19
9 0.14
10 0.13
11 0.15
12 0.18
13 0.24
14 0.32
15 0.36
16 0.42
17 0.49
18 0.53
19 0.59
20 0.63
21 0.66
22 0.69
23 0.71
24 0.74
25 0.78
26 0.82
27 0.78
28 0.73
29 0.66
30 0.62
31 0.6
32 0.6
33 0.52
34 0.46
35 0.45
36 0.42
37 0.43
38 0.39
39 0.35
40 0.26
41 0.23
42 0.2
43 0.17
44 0.15
45 0.12
46 0.11
47 0.12
48 0.11
49 0.14
50 0.15
51 0.14
52 0.14
53 0.14
54 0.15
55 0.17
56 0.18
57 0.16
58 0.16
59 0.19
60 0.25
61 0.25
62 0.29
63 0.34
64 0.37
65 0.42
66 0.45
67 0.44
68 0.44
69 0.46
70 0.48
71 0.47
72 0.46
73 0.45
74 0.52
75 0.55
76 0.56
77 0.6
78 0.57
79 0.58
80 0.65
81 0.68
82 0.68
83 0.68
84 0.69
85 0.72
86 0.75
87 0.71
88 0.63
89 0.56
90 0.47
91 0.43
92 0.37
93 0.29
94 0.22
95 0.18
96 0.16
97 0.14
98 0.12
99 0.11
100 0.09
101 0.08
102 0.07
103 0.07
104 0.07
105 0.08
106 0.1
107 0.11
108 0.11
109 0.11
110 0.12
111 0.14
112 0.15
113 0.16
114 0.14
115 0.16
116 0.18
117 0.19
118 0.2
119 0.17
120 0.16
121 0.17
122 0.18
123 0.16
124 0.15
125 0.15
126 0.15
127 0.16
128 0.2
129 0.2
130 0.2
131 0.24
132 0.22
133 0.23
134 0.24
135 0.24
136 0.24
137 0.29
138 0.32
139 0.39
140 0.43
141 0.43
142 0.46
143 0.48
144 0.51
145 0.47
146 0.42
147 0.4
148 0.35
149 0.33
150 0.3
151 0.27
152 0.2
153 0.17
154 0.16
155 0.08
156 0.09
157 0.07
158 0.07
159 0.08
160 0.08
161 0.09
162 0.1
163 0.11
164 0.13
165 0.21
166 0.24
167 0.3
168 0.35
169 0.37
170 0.44
171 0.48
172 0.49
173 0.46
174 0.48
175 0.44
176 0.44
177 0.44
178 0.36
179 0.32
180 0.27
181 0.24
182 0.17
183 0.16
184 0.12
185 0.09
186 0.1
187 0.13
188 0.14
189 0.14
190 0.14
191 0.16
192 0.17
193 0.22
194 0.22
195 0.22
196 0.23
197 0.25
198 0.24
199 0.23
200 0.21
201 0.18
202 0.18