Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q75CJ5

Protein Details
Accession Q75CJ5    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
95-120ERRILPKPSRRSRQTQKRPRSRTLTAHydrophilic
NLS Segment(s)
PositionSequence
98-114ILPKPSRRSRQTQKRPR
Subcellular Location(s) cyto_nucl 13.333, cyto 12.5, nucl 11, mito_nucl 6.999, cyto_pero 6.999
Family & Domain DBs
InterPro View protein in InterPro  
IPR000554  Ribosomal_S7e  
Gene Ontology GO:0022627  C:cytosolic small ribosomal subunit  
GO:0032040  C:small-subunit processome  
GO:0003735  F:structural constituent of ribosome  
GO:0042274  P:ribosomal small subunit biogenesis  
GO:0006364  P:rRNA processing  
GO:0006412  P:translation  
KEGG ago:AGOS_ACL076W  -  
Pfam View protein in Pfam  
PF01251  Ribosomal_S7e  
PROSITE View protein in PROSITE  
PS00948  RIBOSOMAL_S7E  
Amino Acid Sequences MSAPQAKILSQAPTELELQVAQAFIDLENSSPELKADLRPLQFKSIREIDVAGGKKALAIFVPVPSLAGYHKVQTKLTRELEKKFQDRHVIFLAERRILPKPSRRSRQTQKRPRSRTLTAVHDKILEDLVFPTEIVGKRVRYLVGGNKIQKVLLDSKDVQQVDYKLESFQAVYNKLTGKQIVFEIPSETH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.19
3 0.17
4 0.13
5 0.13
6 0.12
7 0.1
8 0.08
9 0.07
10 0.07
11 0.06
12 0.08
13 0.07
14 0.07
15 0.09
16 0.1
17 0.1
18 0.1
19 0.1
20 0.1
21 0.11
22 0.14
23 0.18
24 0.23
25 0.26
26 0.31
27 0.33
28 0.39
29 0.42
30 0.4
31 0.41
32 0.39
33 0.37
34 0.33
35 0.32
36 0.25
37 0.28
38 0.28
39 0.21
40 0.17
41 0.16
42 0.16
43 0.15
44 0.13
45 0.07
46 0.08
47 0.08
48 0.08
49 0.09
50 0.08
51 0.08
52 0.08
53 0.08
54 0.07
55 0.1
56 0.1
57 0.12
58 0.16
59 0.18
60 0.2
61 0.24
62 0.29
63 0.32
64 0.36
65 0.41
66 0.41
67 0.43
68 0.5
69 0.52
70 0.52
71 0.48
72 0.47
73 0.48
74 0.45
75 0.45
76 0.39
77 0.33
78 0.28
79 0.29
80 0.27
81 0.19
82 0.19
83 0.18
84 0.17
85 0.19
86 0.23
87 0.28
88 0.36
89 0.44
90 0.53
91 0.56
92 0.63
93 0.71
94 0.78
95 0.81
96 0.82
97 0.83
98 0.85
99 0.87
100 0.86
101 0.82
102 0.74
103 0.71
104 0.66
105 0.65
106 0.6
107 0.54
108 0.47
109 0.41
110 0.38
111 0.3
112 0.26
113 0.16
114 0.1
115 0.09
116 0.09
117 0.08
118 0.08
119 0.07
120 0.1
121 0.11
122 0.13
123 0.16
124 0.15
125 0.17
126 0.18
127 0.18
128 0.15
129 0.19
130 0.24
131 0.3
132 0.36
133 0.38
134 0.39
135 0.39
136 0.38
137 0.35
138 0.31
139 0.28
140 0.24
141 0.27
142 0.25
143 0.28
144 0.35
145 0.35
146 0.31
147 0.3
148 0.29
149 0.27
150 0.28
151 0.25
152 0.19
153 0.2
154 0.2
155 0.16
156 0.19
157 0.2
158 0.2
159 0.2
160 0.23
161 0.25
162 0.26
163 0.29
164 0.28
165 0.23
166 0.23
167 0.24
168 0.25
169 0.25
170 0.23