Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A550C2W1

Protein Details
Accession A0A550C2W1   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
32-52ASRPVKPSRRAIERRRVSRPWHydrophilic
NLS Segment(s)
PositionSequence
32-47ASRPVKPSRRAIERRR
Subcellular Location(s) mito 25
Family & Domain DBs
Amino Acid Sequences MRSRVAPPSRDRVSPSPPGILEPAMRPRSTAASRPVKPSRRAIERRRVSRPWLHTVQPCAHPTSPLTSGDGRLTMLETREELRQASKHHPRQTCRHGCQEELPGRARPKRCRSDGTKVVAGERETCLLPTSGAHVRMALVFEGRCAQSIPHGAVLLGCTSEQLAVYEGVTEAVCMKDAACVKDG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.54
3 0.49
4 0.45
5 0.44
6 0.4
7 0.35
8 0.3
9 0.26
10 0.33
11 0.31
12 0.31
13 0.29
14 0.29
15 0.35
16 0.36
17 0.37
18 0.37
19 0.44
20 0.47
21 0.55
22 0.62
23 0.63
24 0.64
25 0.67
26 0.67
27 0.68
28 0.74
29 0.75
30 0.77
31 0.78
32 0.81
33 0.8
34 0.76
35 0.71
36 0.7
37 0.67
38 0.64
39 0.59
40 0.56
41 0.52
42 0.53
43 0.51
44 0.48
45 0.43
46 0.4
47 0.36
48 0.32
49 0.29
50 0.28
51 0.25
52 0.2
53 0.21
54 0.17
55 0.18
56 0.18
57 0.17
58 0.13
59 0.11
60 0.11
61 0.09
62 0.09
63 0.08
64 0.08
65 0.09
66 0.1
67 0.11
68 0.1
69 0.11
70 0.13
71 0.16
72 0.25
73 0.33
74 0.39
75 0.47
76 0.52
77 0.54
78 0.6
79 0.67
80 0.68
81 0.62
82 0.64
83 0.58
84 0.53
85 0.52
86 0.52
87 0.45
88 0.38
89 0.36
90 0.32
91 0.35
92 0.39
93 0.43
94 0.44
95 0.5
96 0.55
97 0.57
98 0.6
99 0.63
100 0.68
101 0.69
102 0.65
103 0.6
104 0.52
105 0.49
106 0.44
107 0.37
108 0.29
109 0.22
110 0.18
111 0.14
112 0.14
113 0.13
114 0.11
115 0.1
116 0.08
117 0.12
118 0.14
119 0.15
120 0.15
121 0.14
122 0.14
123 0.15
124 0.15
125 0.11
126 0.1
127 0.08
128 0.09
129 0.12
130 0.12
131 0.12
132 0.11
133 0.11
134 0.13
135 0.17
136 0.18
137 0.17
138 0.17
139 0.16
140 0.16
141 0.17
142 0.13
143 0.1
144 0.08
145 0.06
146 0.06
147 0.07
148 0.07
149 0.07
150 0.08
151 0.08
152 0.08
153 0.08
154 0.08
155 0.09
156 0.08
157 0.08
158 0.07
159 0.07
160 0.08
161 0.07
162 0.07
163 0.12
164 0.16