Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A550BTL1

Protein Details
Accession A0A550BTL1   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
16-39GDGREGGRRARRQRGRRADCGMGRBasic
NLS Segment(s)
PositionSequence
21-32GGRRARRQRGRR
Subcellular Location(s) cyto 17, cyto_nucl 12.5, nucl 6, mito 3
Family & Domain DBs
Amino Acid Sequences MGMMLDGGHDIVGWAGDGREGGRRARRQRGRRADCGMGRRHYVGGRGVVDRTRAGGGGGASNERASGSIVVEQSRGGVDRSWCGRRAVVNWTLVREGVNRALARRVDWTRETRRLDASDVLAGRERRVGRTRYTRLPDARQPSIGRETPVYWTQEGHRPDARDVSSVDAPCFLSLQPILVDAAKLLSAKTPPPAIYKDSPGFPSTWTSPPFPSTSRTTTEISDSPSFLSTSETPPGFH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.05
4 0.05
5 0.06
6 0.13
7 0.15
8 0.21
9 0.29
10 0.39
11 0.47
12 0.58
13 0.67
14 0.71
15 0.8
16 0.85
17 0.85
18 0.84
19 0.82
20 0.8
21 0.76
22 0.74
23 0.71
24 0.64
25 0.58
26 0.52
27 0.48
28 0.4
29 0.37
30 0.33
31 0.3
32 0.28
33 0.27
34 0.27
35 0.26
36 0.26
37 0.23
38 0.21
39 0.17
40 0.14
41 0.13
42 0.12
43 0.11
44 0.11
45 0.12
46 0.11
47 0.11
48 0.1
49 0.1
50 0.09
51 0.08
52 0.07
53 0.07
54 0.07
55 0.1
56 0.11
57 0.12
58 0.12
59 0.11
60 0.11
61 0.1
62 0.1
63 0.08
64 0.09
65 0.1
66 0.14
67 0.19
68 0.22
69 0.23
70 0.24
71 0.25
72 0.25
73 0.26
74 0.28
75 0.27
76 0.29
77 0.28
78 0.29
79 0.27
80 0.25
81 0.23
82 0.18
83 0.16
84 0.13
85 0.16
86 0.15
87 0.15
88 0.19
89 0.18
90 0.18
91 0.22
92 0.21
93 0.21
94 0.24
95 0.31
96 0.34
97 0.42
98 0.44
99 0.4
100 0.41
101 0.39
102 0.37
103 0.31
104 0.25
105 0.2
106 0.17
107 0.15
108 0.16
109 0.15
110 0.13
111 0.16
112 0.16
113 0.18
114 0.23
115 0.25
116 0.28
117 0.38
118 0.42
119 0.45
120 0.5
121 0.52
122 0.51
123 0.54
124 0.54
125 0.51
126 0.48
127 0.44
128 0.4
129 0.37
130 0.38
131 0.34
132 0.29
133 0.24
134 0.23
135 0.23
136 0.25
137 0.24
138 0.19
139 0.18
140 0.2
141 0.25
142 0.26
143 0.27
144 0.27
145 0.27
146 0.28
147 0.32
148 0.3
149 0.25
150 0.24
151 0.24
152 0.25
153 0.23
154 0.22
155 0.18
156 0.18
157 0.16
158 0.16
159 0.11
160 0.09
161 0.09
162 0.1
163 0.08
164 0.09
165 0.09
166 0.09
167 0.09
168 0.06
169 0.07
170 0.07
171 0.07
172 0.06
173 0.08
174 0.09
175 0.11
176 0.14
177 0.17
178 0.18
179 0.22
180 0.25
181 0.29
182 0.31
183 0.36
184 0.37
185 0.37
186 0.38
187 0.35
188 0.32
189 0.28
190 0.3
191 0.27
192 0.29
193 0.29
194 0.3
195 0.3
196 0.33
197 0.35
198 0.31
199 0.32
200 0.32
201 0.34
202 0.35
203 0.37
204 0.36
205 0.34
206 0.38
207 0.36
208 0.36
209 0.34
210 0.3
211 0.27
212 0.27
213 0.25
214 0.2
215 0.23
216 0.19
217 0.21
218 0.26