Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A550CQY5

Protein Details
Accession A0A550CQY5    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
39-58LSRRRELKKRGQCTRNKVSAHydrophilic
NLS Segment(s)
PositionSequence
40-48SRRRELKKR
Subcellular Location(s) nucl 18, cyto_nucl 11, mito 7
Family & Domain DBs
Amino Acid Sequences MATYTSLLRHRVLELQKPQRNPPLSHSTTSLHRPSARALSRRRELKKRGQCTRNKVSAARTNDDTRPPFAQARAIP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.52
3 0.56
4 0.58
5 0.62
6 0.63
7 0.63
8 0.56
9 0.53
10 0.53
11 0.5
12 0.48
13 0.46
14 0.39
15 0.37
16 0.41
17 0.36
18 0.29
19 0.27
20 0.26
21 0.26
22 0.32
23 0.33
24 0.34
25 0.37
26 0.42
27 0.47
28 0.55
29 0.59
30 0.6
31 0.62
32 0.66
33 0.71
34 0.73
35 0.77
36 0.77
37 0.79
38 0.79
39 0.82
40 0.79
41 0.72
42 0.65
43 0.63
44 0.62
45 0.6
46 0.56
47 0.51
48 0.48
49 0.49
50 0.53
51 0.48
52 0.44
53 0.4
54 0.4
55 0.38
56 0.35