Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5DGF8

Protein Details
Accession C5DGF8    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
113-132IQQAKPSKPASGKKKKNKKRBasic
NLS Segment(s)
PositionSequence
117-132KPSKPASGKKKKNKKR
Subcellular Location(s) nucl 16, cyto 6, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039432  SRP9_dom  
KEGG lth:KLTH0D04972g  -  
Pfam View protein in Pfam  
PF05486  SRP9-21  
Amino Acid Sequences MSVDALDSFITNSVTLLEANPSETVLSVTYNPKAKSGKVAFKTHNSKLSTRFKFTTSRSKDVSRLLSALGPRGVSINNGKIEKKRTGKKVQAVGGMSTLLANVDVPEALEEPIQQAKPSKPASGKKKKNKKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.08
4 0.09
5 0.09
6 0.11
7 0.11
8 0.1
9 0.09
10 0.09
11 0.1
12 0.08
13 0.09
14 0.1
15 0.13
16 0.17
17 0.22
18 0.23
19 0.26
20 0.28
21 0.27
22 0.35
23 0.38
24 0.43
25 0.44
26 0.5
27 0.49
28 0.56
29 0.63
30 0.58
31 0.58
32 0.52
33 0.48
34 0.5
35 0.57
36 0.52
37 0.5
38 0.47
39 0.42
40 0.46
41 0.47
42 0.49
43 0.46
44 0.46
45 0.45
46 0.46
47 0.46
48 0.44
49 0.43
50 0.33
51 0.27
52 0.22
53 0.21
54 0.19
55 0.17
56 0.13
57 0.1
58 0.09
59 0.09
60 0.09
61 0.09
62 0.11
63 0.14
64 0.16
65 0.18
66 0.2
67 0.23
68 0.28
69 0.34
70 0.4
71 0.44
72 0.49
73 0.57
74 0.63
75 0.67
76 0.7
77 0.66
78 0.63
79 0.56
80 0.48
81 0.39
82 0.31
83 0.23
84 0.16
85 0.12
86 0.06
87 0.05
88 0.04
89 0.04
90 0.04
91 0.04
92 0.04
93 0.05
94 0.06
95 0.07
96 0.07
97 0.07
98 0.09
99 0.14
100 0.14
101 0.15
102 0.18
103 0.21
104 0.29
105 0.32
106 0.36
107 0.4
108 0.49
109 0.59
110 0.66
111 0.74
112 0.78