Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A550BWF9

Protein Details
Accession A0A550BWF9   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
74-94LVRARQLPRRHHYRRAPLDPPBasic
NLS Segment(s)
Subcellular Location(s) mito 8plas 8, extr 6, cyto_mito 6
Family & Domain DBs
Amino Acid Sequences MIPHTFLDALWLHLAGRAECIIFSIIPCISSFFRPSISSQLSRYLPHALLLGISFSDATLFTLVSNYSFSHRLLVRARQLPRRHHYRRAPLDPPAHRLTVHL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.12
3 0.13
4 0.11
5 0.11
6 0.1
7 0.11
8 0.1
9 0.08
10 0.08
11 0.09
12 0.08
13 0.09
14 0.09
15 0.11
16 0.11
17 0.13
18 0.15
19 0.13
20 0.15
21 0.16
22 0.18
23 0.22
24 0.24
25 0.25
26 0.24
27 0.29
28 0.28
29 0.28
30 0.28
31 0.24
32 0.2
33 0.18
34 0.18
35 0.12
36 0.1
37 0.09
38 0.08
39 0.04
40 0.04
41 0.04
42 0.03
43 0.03
44 0.03
45 0.04
46 0.04
47 0.04
48 0.04
49 0.05
50 0.05
51 0.05
52 0.07
53 0.07
54 0.09
55 0.1
56 0.11
57 0.15
58 0.15
59 0.2
60 0.23
61 0.29
62 0.34
63 0.4
64 0.46
65 0.5
66 0.57
67 0.61
68 0.66
69 0.71
70 0.7
71 0.73
72 0.77
73 0.8
74 0.83
75 0.82
76 0.78
77 0.76
78 0.78
79 0.73
80 0.7
81 0.63
82 0.54