Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A550CR76

Protein Details
Accession A0A550CR76    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
157-183MGEDERNRRRKEKRRRLPEDKSPQPSNBasic
NLS Segment(s)
PositionSequence
162-174RNRRRKEKRRRLP
Subcellular Location(s) nucl 22, cyto_nucl 13.5, cyto 3
Family & Domain DBs
Amino Acid Sequences MAKKKSGTQRAAKGAPAPDDAPLRNTRARKNSTNDREHAASPINPDDGPARPGTSGQPDPVNEDSSRLTSVTPTESQRWSDRPEFDNELPDASHLIKGSGDGDKEQVTTDPTNESTSTGVDDHGSSNAMNEDTFGERRALATATNRNEQSLAIEDVMGEDERNRRRKEKRRRLPEDKSPQPSNATFDSDTRAYVDANFPKEAAQRLRLRIREEAARLGRPLTAGDMETIIEEGLLEVIQDRQTYYLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.51
3 0.45
4 0.37
5 0.32
6 0.33
7 0.32
8 0.31
9 0.3
10 0.32
11 0.35
12 0.4
13 0.45
14 0.51
15 0.57
16 0.6
17 0.66
18 0.71
19 0.75
20 0.77
21 0.71
22 0.67
23 0.63
24 0.56
25 0.5
26 0.43
27 0.35
28 0.3
29 0.3
30 0.26
31 0.22
32 0.22
33 0.21
34 0.2
35 0.2
36 0.17
37 0.16
38 0.14
39 0.16
40 0.17
41 0.22
42 0.22
43 0.22
44 0.25
45 0.24
46 0.29
47 0.3
48 0.3
49 0.23
50 0.23
51 0.22
52 0.2
53 0.21
54 0.16
55 0.14
56 0.12
57 0.13
58 0.15
59 0.17
60 0.18
61 0.21
62 0.23
63 0.26
64 0.29
65 0.31
66 0.33
67 0.35
68 0.36
69 0.35
70 0.39
71 0.42
72 0.39
73 0.39
74 0.33
75 0.29
76 0.24
77 0.22
78 0.17
79 0.12
80 0.12
81 0.08
82 0.08
83 0.07
84 0.08
85 0.09
86 0.09
87 0.09
88 0.08
89 0.1
90 0.1
91 0.1
92 0.1
93 0.09
94 0.1
95 0.1
96 0.1
97 0.11
98 0.11
99 0.13
100 0.12
101 0.13
102 0.1
103 0.1
104 0.1
105 0.09
106 0.08
107 0.07
108 0.07
109 0.07
110 0.07
111 0.07
112 0.06
113 0.06
114 0.06
115 0.06
116 0.05
117 0.05
118 0.06
119 0.08
120 0.08
121 0.09
122 0.09
123 0.09
124 0.09
125 0.1
126 0.09
127 0.08
128 0.13
129 0.19
130 0.21
131 0.26
132 0.25
133 0.25
134 0.25
135 0.23
136 0.2
137 0.16
138 0.14
139 0.1
140 0.1
141 0.09
142 0.09
143 0.1
144 0.09
145 0.06
146 0.06
147 0.13
148 0.2
149 0.28
150 0.31
151 0.38
152 0.49
153 0.6
154 0.7
155 0.75
156 0.79
157 0.83
158 0.9
159 0.92
160 0.91
161 0.91
162 0.9
163 0.88
164 0.85
165 0.76
166 0.68
167 0.62
168 0.55
169 0.48
170 0.39
171 0.35
172 0.28
173 0.26
174 0.28
175 0.24
176 0.23
177 0.2
178 0.19
179 0.14
180 0.15
181 0.21
182 0.21
183 0.24
184 0.24
185 0.22
186 0.24
187 0.26
188 0.31
189 0.28
190 0.32
191 0.35
192 0.42
193 0.5
194 0.52
195 0.54
196 0.53
197 0.53
198 0.52
199 0.48
200 0.5
201 0.46
202 0.45
203 0.42
204 0.37
205 0.34
206 0.27
207 0.25
208 0.19
209 0.16
210 0.13
211 0.13
212 0.13
213 0.12
214 0.12
215 0.12
216 0.08
217 0.06
218 0.06
219 0.05
220 0.05
221 0.04
222 0.04
223 0.04
224 0.07
225 0.09
226 0.09
227 0.1