Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A550C2B6

Protein Details
Accession A0A550C2B6    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
66-87KVEAEKEKREHKRLYPNYKFAPBasic
NLS Segment(s)
Subcellular Location(s) mito_nucl 14, nucl 13, mito 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01389  HMG-box_ROX1-like  
Amino Acid Sequences MVSRKSKTSPTHVPRPANMYMLFRRARQAEIVAENTDPTVPPQQNLSKRIGREWNALSPEDRRYWKVEAEKEKREHKRLYPNYKFAP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.66
3 0.59
4 0.52
5 0.45
6 0.4
7 0.35
8 0.38
9 0.36
10 0.31
11 0.33
12 0.31
13 0.3
14 0.26
15 0.25
16 0.22
17 0.23
18 0.24
19 0.2
20 0.19
21 0.17
22 0.16
23 0.14
24 0.1
25 0.09
26 0.13
27 0.12
28 0.13
29 0.17
30 0.22
31 0.28
32 0.3
33 0.34
34 0.31
35 0.32
36 0.36
37 0.39
38 0.36
39 0.36
40 0.36
41 0.36
42 0.34
43 0.35
44 0.32
45 0.28
46 0.29
47 0.28
48 0.28
49 0.26
50 0.27
51 0.29
52 0.34
53 0.39
54 0.44
55 0.5
56 0.55
57 0.61
58 0.64
59 0.72
60 0.75
61 0.75
62 0.74
63 0.72
64 0.75
65 0.77
66 0.81
67 0.81