Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A550CW08

Protein Details
Accession A0A550CW08   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MAPYIHRYDRRRRRRARPRDRLGKPRLPKLGBasic
NLS Segment(s)
PositionSequence
10-35RRRRRRARPRDRLGKPRLPKLGKKGT
Subcellular Location(s) mito 15, cyto 6.5, cyto_nucl 6.5, nucl 5.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MAPYIHRYDRRRRRRARPRDRLGKPRLPKLGKKGTWKGLFFRAFLAAGVCVGAWYGYTQYKRKQRYTGFGSGFGSSGGIDRGGGPFGGLYSDDKRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.94
3 0.94
4 0.94
5 0.94
6 0.94
7 0.93
8 0.92
9 0.9
10 0.88
11 0.84
12 0.81
13 0.8
14 0.75
15 0.72
16 0.71
17 0.72
18 0.68
19 0.7
20 0.69
21 0.68
22 0.68
23 0.64
24 0.57
25 0.55
26 0.51
27 0.42
28 0.36
29 0.28
30 0.22
31 0.2
32 0.17
33 0.09
34 0.07
35 0.06
36 0.05
37 0.03
38 0.03
39 0.03
40 0.02
41 0.03
42 0.05
43 0.08
44 0.12
45 0.16
46 0.24
47 0.32
48 0.39
49 0.44
50 0.51
51 0.53
52 0.59
53 0.63
54 0.64
55 0.58
56 0.54
57 0.5
58 0.42
59 0.37
60 0.28
61 0.21
62 0.12
63 0.1
64 0.08
65 0.06
66 0.06
67 0.06
68 0.07
69 0.08
70 0.07
71 0.07
72 0.06
73 0.06
74 0.07
75 0.08
76 0.11