Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A550CWR6

Protein Details
Accession A0A550CWR6   
Localization Confidence Low
Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
90-110VRPAACYHPRRLRSRKQMTEMHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito 6, cyto 6, cyto_mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR013724  GIT_SHD  
Gene Ontology GO:0110165  C:cellular anatomical entity  
Pfam View protein in Pfam  
PF08518  GIT_SHD  
Amino Acid Sequences MYSPRMYSGTTKVHHNPDIQNVLERWKTHLDDFVWYLGEFLDIAYPDYKPVKRTRRDLTRIATIHFEELLTDVLDEVDRRRAEDGASDRVRPAACYHPRRLRSRKQMTEMSATAFYDFCSDVHFELLRRYGLVLQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.52
3 0.49
4 0.49
5 0.52
6 0.45
7 0.43
8 0.36
9 0.38
10 0.37
11 0.33
12 0.3
13 0.3
14 0.32
15 0.28
16 0.33
17 0.28
18 0.28
19 0.29
20 0.26
21 0.21
22 0.19
23 0.18
24 0.12
25 0.11
26 0.08
27 0.06
28 0.06
29 0.05
30 0.07
31 0.07
32 0.07
33 0.09
34 0.14
35 0.15
36 0.18
37 0.27
38 0.35
39 0.41
40 0.49
41 0.56
42 0.62
43 0.66
44 0.69
45 0.64
46 0.63
47 0.57
48 0.51
49 0.43
50 0.33
51 0.28
52 0.22
53 0.17
54 0.09
55 0.08
56 0.08
57 0.05
58 0.05
59 0.04
60 0.04
61 0.05
62 0.05
63 0.05
64 0.1
65 0.1
66 0.11
67 0.12
68 0.13
69 0.13
70 0.18
71 0.21
72 0.24
73 0.26
74 0.26
75 0.25
76 0.27
77 0.27
78 0.22
79 0.21
80 0.23
81 0.3
82 0.36
83 0.45
84 0.52
85 0.59
86 0.68
87 0.74
88 0.74
89 0.76
90 0.81
91 0.81
92 0.79
93 0.78
94 0.73
95 0.71
96 0.61
97 0.53
98 0.44
99 0.36
100 0.29
101 0.22
102 0.18
103 0.14
104 0.13
105 0.1
106 0.11
107 0.12
108 0.12
109 0.15
110 0.16
111 0.15
112 0.19
113 0.22
114 0.2
115 0.19
116 0.2