Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C5DF97

Protein Details
Accession C5DF97    Localization Confidence High Confidence Score 17.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MPQKALKVTKKTKDPRRVTKKQKNLRAAAPHydrophilic
NLS Segment(s)
PositionSequence
7-45KVTKKTKDPRRVTKKQKNLRAAAPLQIKSKKKSLAHMKK
84-86GKK
Subcellular Location(s) nucl 20, cyto 4, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR019034  UPF0390  
KEGG lth:KLTH0D13354g  -  
Pfam View protein in Pfam  
PF09495  DUF2462  
Amino Acid Sequences MPQKALKVTKKTKDPRRVTKKQKNLRAAAPLQIKSKKKSLAHMKKLNRASSLTEATEKLIASRVGHLELLKGTRKELAGQGSKGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.88
3 0.89
4 0.91
5 0.91
6 0.92
7 0.92
8 0.91
9 0.91
10 0.89
11 0.83
12 0.77
13 0.73
14 0.64
15 0.6
16 0.56
17 0.49
18 0.46
19 0.48
20 0.47
21 0.42
22 0.46
23 0.46
24 0.41
25 0.47
26 0.53
27 0.57
28 0.63
29 0.69
30 0.69
31 0.7
32 0.73
33 0.67
34 0.57
35 0.48
36 0.41
37 0.37
38 0.34
39 0.27
40 0.23
41 0.21
42 0.2
43 0.2
44 0.16
45 0.12
46 0.13
47 0.12
48 0.11
49 0.14
50 0.14
51 0.14
52 0.16
53 0.15
54 0.14
55 0.15
56 0.18
57 0.22
58 0.21
59 0.2
60 0.23
61 0.24
62 0.25
63 0.28
64 0.33
65 0.33
66 0.36