Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C5DEV8

Protein Details
Accession C5DEV8    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
441-469GDLERDEKSKQRFKNKTKKQAPTKTIGNVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto_nucl 13.333, cyto 8.5, cyto_mito 5.832
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR017930  Myb_dom  
IPR001005  SANT/Myb  
IPR013867  Telomere_rpt-bd_fac_dimer_dom  
Gene Ontology GO:0005634  C:nucleus  
GO:0042803  F:protein homodimerization activity  
GO:0042162  F:telomeric DNA binding  
GO:0007049  P:cell cycle  
KEGG lth:KLTH0D10164g  -  
Pfam View protein in Pfam  
PF00249  Myb_DNA-binding  
PF08558  TRF  
PROSITE View protein in PROSITE  
PS51294  HTH_MYB  
CDD cd11660  SANT_TRF  
Amino Acid Sequences MSEALPAKDTDPLKSDDIKTGKVIAELPPRTQLNINSIGLLDNVSTQLLKLLMTSSIETLIGFTSAQSDGYQSEVFEMLFALFKQVKKVYTSAPLLVVQDIAPGLWLEDEKCPYILKNQENLVLAAIRKANIVTYLLSIMGRLQYGFLFLDESFIEIFCPVAGDLPFEAERALTTSLGRLLKPQAVLYLNLKTHAYISAIEPYRDNAEALSRVREEILDRIFAKNMEQFILAKRRMRSSKLSPSEEDFVKRCVHRREKLQSQDSLDLLVAEYDWLEFFKEIFFYLQRNISVLVWGKKGCDFASPGSDVSASDINADQPMSSLNNGSAESSRASSEPPVGKPLSSSSSLRPSPAPLRDAASAKKLKQKRLWNKEEEGALIEALKVHGPAWSKILELHGAGGSLSESLKNRTQVQLKDKARNWKMYFLKGGLPVPDYLAKVTGDLERDEKSKQRFKNKTKKQAPTKTIGNVEKPHEPTQDLRKVANMSIVAQAGRSEFPIEEANASEMDPQLQAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.37
3 0.39
4 0.42
5 0.41
6 0.39
7 0.39
8 0.36
9 0.31
10 0.31
11 0.29
12 0.36
13 0.36
14 0.36
15 0.39
16 0.39
17 0.4
18 0.42
19 0.38
20 0.34
21 0.39
22 0.37
23 0.3
24 0.3
25 0.28
26 0.24
27 0.21
28 0.14
29 0.08
30 0.09
31 0.08
32 0.08
33 0.07
34 0.09
35 0.09
36 0.08
37 0.08
38 0.09
39 0.09
40 0.11
41 0.12
42 0.11
43 0.12
44 0.12
45 0.11
46 0.11
47 0.09
48 0.08
49 0.07
50 0.06
51 0.08
52 0.08
53 0.09
54 0.09
55 0.09
56 0.09
57 0.13
58 0.13
59 0.1
60 0.12
61 0.12
62 0.11
63 0.1
64 0.1
65 0.07
66 0.08
67 0.08
68 0.11
69 0.14
70 0.15
71 0.21
72 0.23
73 0.25
74 0.27
75 0.3
76 0.29
77 0.34
78 0.36
79 0.32
80 0.32
81 0.31
82 0.29
83 0.26
84 0.23
85 0.15
86 0.13
87 0.11
88 0.08
89 0.07
90 0.06
91 0.05
92 0.05
93 0.06
94 0.07
95 0.1
96 0.13
97 0.14
98 0.14
99 0.15
100 0.15
101 0.22
102 0.28
103 0.3
104 0.33
105 0.34
106 0.38
107 0.39
108 0.38
109 0.32
110 0.26
111 0.21
112 0.18
113 0.17
114 0.13
115 0.12
116 0.12
117 0.11
118 0.11
119 0.12
120 0.1
121 0.09
122 0.1
123 0.1
124 0.1
125 0.09
126 0.09
127 0.08
128 0.08
129 0.07
130 0.07
131 0.06
132 0.08
133 0.08
134 0.07
135 0.08
136 0.08
137 0.09
138 0.09
139 0.09
140 0.08
141 0.08
142 0.08
143 0.06
144 0.06
145 0.04
146 0.05
147 0.04
148 0.06
149 0.06
150 0.07
151 0.07
152 0.1
153 0.1
154 0.1
155 0.1
156 0.07
157 0.08
158 0.09
159 0.1
160 0.07
161 0.08
162 0.08
163 0.13
164 0.15
165 0.14
166 0.15
167 0.16
168 0.18
169 0.19
170 0.18
171 0.17
172 0.17
173 0.19
174 0.19
175 0.21
176 0.19
177 0.19
178 0.19
179 0.16
180 0.15
181 0.14
182 0.13
183 0.09
184 0.1
185 0.17
186 0.18
187 0.18
188 0.17
189 0.17
190 0.19
191 0.18
192 0.17
193 0.09
194 0.1
195 0.13
196 0.14
197 0.15
198 0.13
199 0.13
200 0.13
201 0.13
202 0.13
203 0.13
204 0.14
205 0.14
206 0.15
207 0.15
208 0.16
209 0.15
210 0.16
211 0.14
212 0.14
213 0.12
214 0.11
215 0.11
216 0.15
217 0.22
218 0.23
219 0.25
220 0.26
221 0.32
222 0.34
223 0.38
224 0.41
225 0.41
226 0.5
227 0.53
228 0.54
229 0.49
230 0.49
231 0.49
232 0.43
233 0.37
234 0.28
235 0.23
236 0.23
237 0.23
238 0.26
239 0.31
240 0.39
241 0.41
242 0.48
243 0.54
244 0.59
245 0.67
246 0.65
247 0.59
248 0.54
249 0.52
250 0.43
251 0.35
252 0.26
253 0.18
254 0.13
255 0.09
256 0.06
257 0.03
258 0.03
259 0.03
260 0.03
261 0.03
262 0.03
263 0.04
264 0.04
265 0.04
266 0.04
267 0.05
268 0.06
269 0.07
270 0.08
271 0.1
272 0.12
273 0.12
274 0.12
275 0.13
276 0.12
277 0.13
278 0.15
279 0.16
280 0.16
281 0.16
282 0.16
283 0.16
284 0.18
285 0.16
286 0.14
287 0.14
288 0.13
289 0.17
290 0.17
291 0.16
292 0.15
293 0.15
294 0.12
295 0.12
296 0.12
297 0.08
298 0.08
299 0.08
300 0.08
301 0.09
302 0.09
303 0.07
304 0.05
305 0.07
306 0.07
307 0.07
308 0.07
309 0.07
310 0.08
311 0.08
312 0.09
313 0.09
314 0.09
315 0.1
316 0.1
317 0.11
318 0.1
319 0.1
320 0.1
321 0.16
322 0.19
323 0.19
324 0.22
325 0.22
326 0.22
327 0.22
328 0.24
329 0.21
330 0.2
331 0.21
332 0.2
333 0.28
334 0.28
335 0.29
336 0.27
337 0.28
338 0.32
339 0.34
340 0.32
341 0.25
342 0.28
343 0.3
344 0.32
345 0.3
346 0.31
347 0.32
348 0.34
349 0.42
350 0.44
351 0.5
352 0.55
353 0.64
354 0.67
355 0.73
356 0.79
357 0.76
358 0.75
359 0.71
360 0.64
361 0.54
362 0.45
363 0.34
364 0.25
365 0.18
366 0.14
367 0.1
368 0.09
369 0.08
370 0.06
371 0.06
372 0.08
373 0.11
374 0.12
375 0.14
376 0.14
377 0.14
378 0.15
379 0.17
380 0.15
381 0.13
382 0.14
383 0.11
384 0.11
385 0.1
386 0.09
387 0.07
388 0.07
389 0.07
390 0.08
391 0.09
392 0.13
393 0.18
394 0.21
395 0.23
396 0.3
397 0.37
398 0.41
399 0.48
400 0.54
401 0.57
402 0.63
403 0.66
404 0.7
405 0.69
406 0.72
407 0.67
408 0.66
409 0.65
410 0.61
411 0.6
412 0.52
413 0.5
414 0.44
415 0.43
416 0.36
417 0.32
418 0.26
419 0.25
420 0.26
421 0.22
422 0.18
423 0.18
424 0.16
425 0.15
426 0.16
427 0.16
428 0.15
429 0.16
430 0.18
431 0.19
432 0.21
433 0.24
434 0.29
435 0.35
436 0.42
437 0.48
438 0.57
439 0.65
440 0.75
441 0.82
442 0.87
443 0.89
444 0.91
445 0.93
446 0.93
447 0.93
448 0.89
449 0.85
450 0.81
451 0.77
452 0.76
453 0.71
454 0.67
455 0.62
456 0.6
457 0.6
458 0.58
459 0.56
460 0.5
461 0.47
462 0.46
463 0.51
464 0.55
465 0.5
466 0.45
467 0.45
468 0.44
469 0.43
470 0.42
471 0.33
472 0.26
473 0.27
474 0.27
475 0.22
476 0.2
477 0.19
478 0.16
479 0.16
480 0.15
481 0.13
482 0.12
483 0.14
484 0.18
485 0.18
486 0.17
487 0.18
488 0.18
489 0.17
490 0.17
491 0.16
492 0.13
493 0.14