Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A550CYK7

Protein Details
Accession A0A550CYK7    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
311-332VVRERQEKRRREADEREKRVRPBasic
342-372PELGRRKASSSRVRRLRSRSRSRTGERVSAQHydrophilic
NLS Segment(s)
PositionSequence
313-364RERQEKRRREADEREKRVRPTVRFTAIARPELGRRKASSSRVRRLRSRSRSR
Subcellular Location(s) nucl 10.5, cyto_nucl 7.5, mito 5, plas 4, cyto 3.5, extr 2
Family & Domain DBs
Amino Acid Sequences MLARTPSPPTLPAPTATHTSAGEIVPFPYVPTEILRDIVDFAAASSPRSAANLTLTASHVRAWVLPMMYHSVVLSTSPSVSKFLAALTSAHLAPSSRLHLRRPLQDLVRNLAILALGPIDSIACIIERCRYVQNRACGFSLSGYKQRTAPLGSDADADAAARSRLAACEQHFLGLACRDGFHPALIAPSTTHLQLQLVPQSAHLLTGLSTHVPALTHLAVSLSASTPPSTLPQLLPELARVLREHETLQVLMVQVAGFGHVKLTDALEEWQAGPAQDDRVVVCAAPISLVRQWGETSAFKIGGLWRRAEGVVRERQEKRRREADEREKRVRPTVRFTAIARPELGRRKASSSRVRRLRSRSRSRTGERVSAQVQVLPL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.37
3 0.36
4 0.34
5 0.27
6 0.27
7 0.26
8 0.22
9 0.21
10 0.16
11 0.16
12 0.15
13 0.14
14 0.13
15 0.11
16 0.12
17 0.11
18 0.13
19 0.16
20 0.16
21 0.18
22 0.18
23 0.17
24 0.18
25 0.17
26 0.14
27 0.1
28 0.1
29 0.13
30 0.13
31 0.13
32 0.12
33 0.13
34 0.13
35 0.14
36 0.14
37 0.11
38 0.14
39 0.15
40 0.15
41 0.16
42 0.17
43 0.18
44 0.18
45 0.18
46 0.15
47 0.14
48 0.14
49 0.14
50 0.15
51 0.14
52 0.14
53 0.15
54 0.18
55 0.18
56 0.17
57 0.15
58 0.13
59 0.12
60 0.12
61 0.12
62 0.07
63 0.09
64 0.1
65 0.11
66 0.12
67 0.12
68 0.13
69 0.12
70 0.11
71 0.11
72 0.11
73 0.1
74 0.11
75 0.13
76 0.12
77 0.12
78 0.11
79 0.11
80 0.11
81 0.14
82 0.16
83 0.21
84 0.23
85 0.26
86 0.35
87 0.4
88 0.46
89 0.49
90 0.5
91 0.5
92 0.53
93 0.52
94 0.48
95 0.44
96 0.37
97 0.31
98 0.25
99 0.19
100 0.13
101 0.1
102 0.06
103 0.04
104 0.04
105 0.04
106 0.03
107 0.03
108 0.03
109 0.03
110 0.03
111 0.04
112 0.05
113 0.08
114 0.09
115 0.12
116 0.18
117 0.21
118 0.29
119 0.35
120 0.43
121 0.44
122 0.45
123 0.44
124 0.38
125 0.35
126 0.29
127 0.28
128 0.23
129 0.25
130 0.24
131 0.24
132 0.25
133 0.26
134 0.26
135 0.22
136 0.2
137 0.18
138 0.18
139 0.17
140 0.16
141 0.15
142 0.13
143 0.11
144 0.1
145 0.06
146 0.06
147 0.05
148 0.04
149 0.04
150 0.04
151 0.05
152 0.07
153 0.1
154 0.11
155 0.14
156 0.15
157 0.15
158 0.15
159 0.15
160 0.14
161 0.12
162 0.11
163 0.08
164 0.08
165 0.08
166 0.1
167 0.1
168 0.08
169 0.07
170 0.07
171 0.08
172 0.07
173 0.07
174 0.05
175 0.07
176 0.08
177 0.08
178 0.08
179 0.07
180 0.07
181 0.08
182 0.1
183 0.11
184 0.12
185 0.12
186 0.12
187 0.13
188 0.13
189 0.11
190 0.1
191 0.07
192 0.05
193 0.06
194 0.07
195 0.05
196 0.05
197 0.05
198 0.05
199 0.05
200 0.05
201 0.07
202 0.07
203 0.07
204 0.07
205 0.07
206 0.07
207 0.07
208 0.07
209 0.05
210 0.05
211 0.06
212 0.06
213 0.06
214 0.07
215 0.08
216 0.09
217 0.1
218 0.1
219 0.11
220 0.13
221 0.14
222 0.14
223 0.12
224 0.13
225 0.12
226 0.13
227 0.11
228 0.13
229 0.14
230 0.15
231 0.15
232 0.15
233 0.17
234 0.15
235 0.15
236 0.13
237 0.11
238 0.1
239 0.09
240 0.07
241 0.05
242 0.05
243 0.06
244 0.05
245 0.05
246 0.05
247 0.05
248 0.06
249 0.06
250 0.07
251 0.06
252 0.07
253 0.08
254 0.09
255 0.09
256 0.09
257 0.1
258 0.1
259 0.09
260 0.1
261 0.1
262 0.1
263 0.11
264 0.11
265 0.11
266 0.12
267 0.12
268 0.11
269 0.09
270 0.09
271 0.07
272 0.07
273 0.07
274 0.08
275 0.09
276 0.12
277 0.13
278 0.13
279 0.13
280 0.14
281 0.18
282 0.16
283 0.17
284 0.17
285 0.17
286 0.16
287 0.17
288 0.21
289 0.25
290 0.27
291 0.26
292 0.24
293 0.26
294 0.27
295 0.28
296 0.28
297 0.27
298 0.33
299 0.36
300 0.43
301 0.48
302 0.58
303 0.64
304 0.67
305 0.68
306 0.69
307 0.72
308 0.73
309 0.78
310 0.79
311 0.81
312 0.82
313 0.83
314 0.79
315 0.75
316 0.76
317 0.73
318 0.67
319 0.65
320 0.65
321 0.61
322 0.59
323 0.58
324 0.59
325 0.56
326 0.53
327 0.46
328 0.39
329 0.42
330 0.47
331 0.5
332 0.45
333 0.43
334 0.48
335 0.54
336 0.61
337 0.64
338 0.65
339 0.71
340 0.75
341 0.8
342 0.81
343 0.84
344 0.85
345 0.85
346 0.86
347 0.86
348 0.86
349 0.88
350 0.86
351 0.87
352 0.83
353 0.81
354 0.72
355 0.69
356 0.61
357 0.56
358 0.5